BLASTX nr result
ID: Mentha27_contig00022601
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00022601 (290 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006648673.1| PREDICTED: uncharacterized protein LOC102701... 64 3e-08 gb|ABA91962.1| transposon protein, putative, Mariner sub-class [... 61 1e-07 gb|ACV32570.1| mar1 transposase [synthetic construct] 61 1e-07 gb|ABG21770.1| transposase [Phyllostachys edulis] 61 2e-07 gb|ABF93607.1| transposon protein, putative, Mariner sub-class [... 61 2e-07 gb|ABG21747.1| transposase [Gelidocalamus annulatus] 60 2e-07 gb|ABG21761.1| transposase [Phyllostachys edulis] 59 5e-07 gb|AAL69341.1| transposase [Oryza sativa] 59 5e-07 gb|ABG21751.1| transposase [Himalayacalamus intermedius] 59 7e-07 gb|ABG21798.1| transposase [Pleioblastus gramineus] 59 7e-07 gb|ABG21779.1| transposase [Phyllostachys edulis] gi|108861682|g... 59 7e-07 gb|ABG21746.1| transposase [Fargesia fungosa] 59 7e-07 gb|ABG21769.1| transposase [Phyllostachys edulis] gi|108861711|g... 59 7e-07 gb|ABG21781.1| transposase [Phyllostachys edulis] 59 7e-07 gb|ABG21766.1| transposase [Phyllostachys edulis] 59 7e-07 gb|ABG21741.1| transposase [Chimonocalamus pallens] 59 7e-07 gb|ABG21776.1| transposase [Phyllostachys edulis] 59 7e-07 gb|ABG21796.1| transposase [Phyllostachys edulis] 59 7e-07 gb|ABG21792.1| transposase [Phyllostachys edulis] 59 7e-07 gb|ABG21759.1| transposase [Oligostachyum sulcatum] 59 7e-07 >ref|XP_006648673.1| PREDICTED: uncharacterized protein LOC102701146 [Oryza brachyantha] Length = 446 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/57 (52%), Positives = 41/57 (71%) Frame = +2 Query: 2 FGVDGSVLFDGKIGIWAFIEEVIAKRNSIHRKKGTRELKPMQSINREAIRNCIIEKV 172 F DG+ +FDGKIG + F+ AKR+S++R GT ELKP+ SI ++ IRN +IEKV Sbjct: 231 FQSDGNCIFDGKIGCFPFVTYTPAKRSSVNRPAGTMELKPINSITKDIIRNFLIEKV 287 >gb|ABA91962.1| transposon protein, putative, Mariner sub-class [Oryza sativa Japonica Group] Length = 670 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/57 (49%), Positives = 42/57 (73%) Frame = +2 Query: 2 FGVDGSVLFDGKIGIWAFIEEVIAKRNSIHRKKGTRELKPMQSINREAIRNCIIEKV 172 F +G+ +FDGKIG + F+ AKR+S++R GT E+KP++SI +E IR+ +IEKV Sbjct: 434 FDSNGNCIFDGKIGCFPFVTYTAAKRSSVNRPAGTIEMKPIESITKEVIRSFMIEKV 490 >gb|ACV32570.1| mar1 transposase [synthetic construct] Length = 576 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/57 (49%), Positives = 42/57 (73%) Frame = +2 Query: 2 FGVDGSVLFDGKIGIWAFIEEVIAKRNSIHRKKGTRELKPMQSINREAIRNCIIEKV 172 F +G+ +FDGKIG + F+ AKR+S++R GT E+KP++SI +E IR+ +IEKV Sbjct: 362 FDSNGNCIFDGKIGCFPFVTYTAAKRSSVNRPAGTIEMKPIESITKEVIRSFMIEKV 418 >gb|ABG21770.1| transposase [Phyllostachys edulis] Length = 128 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/57 (50%), Positives = 40/57 (70%) Frame = +2 Query: 2 FGVDGSVLFDGKIGIWAFIEEVIAKRNSIHRKKGTRELKPMQSINREAIRNCIIEKV 172 F DG+ FDGKIG + F+ +AKR+S +R GT E+KP++SI +E IR +IEKV Sbjct: 48 FDSDGNCTFDGKIGCFPFVTYELAKRSSANRPAGTIEMKPIESITKEVIRTFLIEKV 104 >gb|ABF93607.1| transposon protein, putative, Mariner sub-class [Oryza sativa Japonica Group] Length = 827 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/57 (49%), Positives = 41/57 (71%) Frame = +2 Query: 2 FGVDGSVLFDGKIGIWAFIEEVIAKRNSIHRKKGTRELKPMQSINREAIRNCIIEKV 172 F +G +FDGKIG + F+ AKR+S++R GT E+KP++SI +E IR+ +IEKV Sbjct: 434 FDSNGKCIFDGKIGCFPFVTYTAAKRSSVNRPAGTIEMKPIESITKEVIRSFMIEKV 490 >gb|ABG21747.1| transposase [Gelidocalamus annulatus] Length = 128 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/57 (52%), Positives = 39/57 (68%) Frame = +2 Query: 2 FGVDGSVLFDGKIGIWAFIEEVIAKRNSIHRKKGTRELKPMQSINREAIRNCIIEKV 172 F DG+ FDGKIG + F+ AKR+S +R GT E+KPM+SI +E IR +IEKV Sbjct: 48 FDSDGNCTFDGKIGCFPFVTYEPAKRSSANRPAGTIEMKPMESITKEVIRTFLIEKV 104 >gb|ABG21761.1| transposase [Phyllostachys edulis] Length = 128 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = +2 Query: 2 FGVDGSVLFDGKIGIWAFIEEVIAKRNSIHRKKGTRELKPMQSINREAIRNCIIEKV 172 F DG+ FDGKIG + F+ AKR+S +R GT E+KP++SI +E IR +IEKV Sbjct: 48 FDSDGNCTFDGKIGCFPFVTYEPAKRSSANRPAGTIEMKPIESITKEVIRTLLIEKV 104 >gb|AAL69341.1| transposase [Oryza sativa] Length = 128 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/57 (47%), Positives = 41/57 (71%) Frame = +2 Query: 2 FGVDGSVLFDGKIGIWAFIEEVIAKRNSIHRKKGTRELKPMQSINREAIRNCIIEKV 172 F +G+ +FDGKIG + F+ KR+S++R GT E+KP++SI +E IR+ +IEKV Sbjct: 48 FDSNGNCIFDGKIGCFPFVTYTAEKRSSVNRPAGTIEMKPIESITKEVIRSFMIEKV 104 >gb|ABG21751.1| transposase [Himalayacalamus intermedius] Length = 128 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = +2 Query: 2 FGVDGSVLFDGKIGIWAFIEEVIAKRNSIHRKKGTRELKPMQSINREAIRNCIIEKV 172 F DG+ FDGKIG + F+ AKR+S +R GT E+KP++SI +E IR +IEKV Sbjct: 48 FDSDGNCTFDGKIGCFPFVTYEPAKRSSANRPAGTIEMKPIESITKEVIRTFLIEKV 104 >gb|ABG21798.1| transposase [Pleioblastus gramineus] Length = 128 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = +2 Query: 2 FGVDGSVLFDGKIGIWAFIEEVIAKRNSIHRKKGTRELKPMQSINREAIRNCIIEKV 172 F DG+ FDGKIG + F+ AKR+S +R GT E+KP++SI +E IR +IEKV Sbjct: 48 FDFDGNCTFDGKIGCFPFVTYEPAKRSSANRPAGTIEMKPIESITKEIIRTFLIEKV 104 >gb|ABG21779.1| transposase [Phyllostachys edulis] gi|108861682|gb|ABG21780.1| transposase [Phyllostachys edulis] Length = 128 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = +2 Query: 2 FGVDGSVLFDGKIGIWAFIEEVIAKRNSIHRKKGTRELKPMQSINREAIRNCIIEKV 172 F DG+ FDGKIG + F+ AKR+S +R GT E+KP++SI +E IR +IEKV Sbjct: 48 FDSDGNCTFDGKIGCFPFVTYEPAKRSSANRPAGTIEIKPIESITKEVIRTFLIEKV 104 >gb|ABG21746.1| transposase [Fargesia fungosa] Length = 128 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = +2 Query: 2 FGVDGSVLFDGKIGIWAFIEEVIAKRNSIHRKKGTRELKPMQSINREAIRNCIIEKV 172 F DG+ FDGKIG + F+ AKR+S +R GT E+KP++SI +E IR +IEKV Sbjct: 48 FDSDGNCTFDGKIGCFPFVTYEPAKRSSANRPTGTIEMKPIESITKEVIRTFLIEKV 104 >gb|ABG21769.1| transposase [Phyllostachys edulis] gi|108861711|gb|ABG21794.1| transposase [Phyllostachys edulis] Length = 128 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = +2 Query: 2 FGVDGSVLFDGKIGIWAFIEEVIAKRNSIHRKKGTRELKPMQSINREAIRNCIIEKV 172 F DG+ FDGKIG + F+ AKR+S +R GT E+KP++SI +E IR +IEKV Sbjct: 48 FDSDGNCTFDGKIGCFPFVTYEPAKRSSANRPAGTIEMKPIESITKEVIRTFLIEKV 104 >gb|ABG21781.1| transposase [Phyllostachys edulis] Length = 128 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = +2 Query: 2 FGVDGSVLFDGKIGIWAFIEEVIAKRNSIHRKKGTRELKPMQSINREAIRNCIIEKV 172 F DG+ FDGKIG + F+ AKR+S +R GT E+KP++SI +E IR +IEKV Sbjct: 48 FDSDGNCTFDGKIGCFPFVTYEPAKRSSANRPAGTIEMKPIESITKEVIRTFLIEKV 104 >gb|ABG21766.1| transposase [Phyllostachys edulis] Length = 128 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = +2 Query: 2 FGVDGSVLFDGKIGIWAFIEEVIAKRNSIHRKKGTRELKPMQSINREAIRNCIIEKV 172 F DG+ FDGKIG + F+ AKR+S +R GT E+KP++SI +E IR +IEKV Sbjct: 48 FDSDGNCTFDGKIGCFPFVTYEPAKRSSANRPAGTIEIKPIESITKEVIRTFLIEKV 104 >gb|ABG21741.1| transposase [Chimonocalamus pallens] Length = 128 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = +2 Query: 2 FGVDGSVLFDGKIGIWAFIEEVIAKRNSIHRKKGTRELKPMQSINREAIRNCIIEKV 172 F DG+ FDGKIG + F+ AKR+S +R GT E+KP++SI +E IR +IEKV Sbjct: 48 FDSDGNCAFDGKIGCFPFVTYEPAKRSSANRPAGTIEMKPIESITKEVIRTFLIEKV 104 >gb|ABG21776.1| transposase [Phyllostachys edulis] Length = 128 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = +2 Query: 2 FGVDGSVLFDGKIGIWAFIEEVIAKRNSIHRKKGTRELKPMQSINREAIRNCIIEKV 172 F DG+ FDGKIG + F+ AKR+S +R GT E+KP++SI +E IR +IEKV Sbjct: 48 FDSDGNCTFDGKIGCFPFVTYEPAKRSSANRPAGTIEMKPIESITKEVIRTFLIEKV 104 >gb|ABG21796.1| transposase [Phyllostachys edulis] Length = 128 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = +2 Query: 2 FGVDGSVLFDGKIGIWAFIEEVIAKRNSIHRKKGTRELKPMQSINREAIRNCIIEKV 172 F DG+ FDGKIG + F+ AKR+S +R GT E+KP++SI +E IR +IEKV Sbjct: 48 FDSDGNCTFDGKIGCFPFVTYEPAKRSSANRPAGTIEIKPIESITKEVIRTFLIEKV 104 >gb|ABG21792.1| transposase [Phyllostachys edulis] Length = 128 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = +2 Query: 2 FGVDGSVLFDGKIGIWAFIEEVIAKRNSIHRKKGTRELKPMQSINREAIRNCIIEKV 172 F DG+ FDGKIG + F+ AKR+S +R GT E+KP++SI +E IR +IEKV Sbjct: 48 FDSDGNCTFDGKIGCFPFVTYEPAKRSSANRPAGTIEMKPIESITKEVIRTFLIEKV 104 >gb|ABG21759.1| transposase [Oligostachyum sulcatum] Length = 128 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = +2 Query: 2 FGVDGSVLFDGKIGIWAFIEEVIAKRNSIHRKKGTRELKPMQSINREAIRNCIIEKV 172 F DG+ FDGKIG + F+ AKR+S +R GT E+KP++SI +E IR +IEKV Sbjct: 48 FDSDGNCTFDGKIGCFPFVTYEPAKRSSANRPAGTIEMKPIESITKEVIRTFLIEKV 104