BLASTX nr result
ID: Mentha27_contig00022541
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00022541 (336 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007028523.1| Tubulin folding cofactor B [Theobroma cacao]... 65 1e-08 gb|EYU37628.1| hypothetical protein MIMGU_mgv1a012750mg [Mimulus... 64 2e-08 ref|XP_006859184.1| hypothetical protein AMTR_s00070p00156670 [A... 63 5e-08 ref|XP_004235379.1| PREDICTED: tubulin-specific chaperone B-like... 62 6e-08 ref|XP_006364381.1| PREDICTED: tubulin-folding cofactor B-like [... 61 2e-07 ref|XP_002274425.1| PREDICTED: tubulin-specific chaperone B isof... 60 2e-07 ref|XP_002274343.1| PREDICTED: tubulin-specific chaperone B isof... 60 2e-07 gb|EXC48536.1| hypothetical protein L484_000576 [Morus notabilis] 60 3e-07 gb|ADE77875.1| unknown [Picea sitchensis] 59 5e-07 gb|EPS70893.1| hypothetical protein M569_03866, partial [Genlise... 59 9e-07 ref|XP_002882657.1| tubulin folding cofactor B [Arabidopsis lyra... 59 9e-07 ref|XP_007223788.1| hypothetical protein PRUPE_ppa010616mg [Prun... 58 1e-06 ref|XP_006492512.1| PREDICTED: tubulin-folding cofactor B-like i... 58 2e-06 ref|XP_006442070.1| hypothetical protein CICLE_v10021922mg [Citr... 58 2e-06 ref|XP_004298196.1| PREDICTED: tubulin-specific chaperone B-like... 58 2e-06 ref|XP_006298430.1| hypothetical protein CARUB_v10014499mg [Caps... 57 3e-06 ref|XP_002529160.1| tubulin-specific chaperone B, putative [Rici... 57 3e-06 ref|XP_006579371.1| PREDICTED: uncharacterized protein LOC100500... 56 6e-06 ref|XP_004514584.1| PREDICTED: tubulin-specific chaperone B-like... 56 6e-06 ref|XP_002307984.1| tubulin folding cofactor B family protein [P... 56 6e-06 >ref|XP_007028523.1| Tubulin folding cofactor B [Theobroma cacao] gi|508717128|gb|EOY09025.1| Tubulin folding cofactor B [Theobroma cacao] Length = 242 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 334 KHDGMVKGKRYFECPPLCGAMVRPDKVQVG 245 KHDGMVKG RYF+CPPLCGAMVRPDKV+VG Sbjct: 200 KHDGMVKGTRYFQCPPLCGAMVRPDKVKVG 229 >gb|EYU37628.1| hypothetical protein MIMGU_mgv1a012750mg [Mimulus guttatus] Length = 241 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 334 KHDGMVKGKRYFECPPLCGAMVRPDKVQVG 245 KHDGMVKGKRYF+CPPLCG +VRPDKV+VG Sbjct: 199 KHDGMVKGKRYFDCPPLCGGIVRPDKVKVG 228 >ref|XP_006859184.1| hypothetical protein AMTR_s00070p00156670 [Amborella trichopoda] gi|548863297|gb|ERN20651.1| hypothetical protein AMTR_s00070p00156670 [Amborella trichopoda] Length = 240 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 334 KHDGMVKGKRYFECPPLCGAMVRPDKVQVG 245 KHDGMVKGKRYFECPPL GAM+RPDKV+VG Sbjct: 198 KHDGMVKGKRYFECPPLHGAMLRPDKVKVG 227 >ref|XP_004235379.1| PREDICTED: tubulin-specific chaperone B-like [Solanum lycopersicum] Length = 243 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 334 KHDGMVKGKRYFECPPLCGAMVRPDKVQVG 245 KHDGMVKGKRYF+CPPL GAMVRPDKV++G Sbjct: 201 KHDGMVKGKRYFDCPPLHGAMVRPDKVKIG 230 >ref|XP_006364381.1| PREDICTED: tubulin-folding cofactor B-like [Solanum tuberosum] Length = 243 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 334 KHDGMVKGKRYFECPPLCGAMVRPDKVQVG 245 KHDGMVKGKRYF+CPPL GA+VRPDKV++G Sbjct: 201 KHDGMVKGKRYFDCPPLHGAIVRPDKVKIG 230 >ref|XP_002274425.1| PREDICTED: tubulin-specific chaperone B isoform 2 [Vitis vinifera] Length = 243 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 334 KHDGMVKGKRYFECPPLCGAMVRPDKVQVG 245 KHDGMVKG RYF+CPPL GAMVRPDKV+VG Sbjct: 201 KHDGMVKGTRYFDCPPLHGAMVRPDKVKVG 230 >ref|XP_002274343.1| PREDICTED: tubulin-specific chaperone B isoform 1 [Vitis vinifera] gi|359482231|ref|XP_003632738.1| PREDICTED: tubulin-specific chaperone B [Vitis vinifera] gi|297739921|emb|CBI30103.3| unnamed protein product [Vitis vinifera] Length = 242 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 334 KHDGMVKGKRYFECPPLCGAMVRPDKVQVG 245 KHDGMVKG RYF+CPPL GAMVRPDKV+VG Sbjct: 200 KHDGMVKGTRYFDCPPLHGAMVRPDKVKVG 229 >gb|EXC48536.1| hypothetical protein L484_000576 [Morus notabilis] Length = 243 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 334 KHDGMVKGKRYFECPPLCGAMVRPDKVQVG 245 KHDG+VKG RYFECPPL GAMVRPDKV+VG Sbjct: 201 KHDGIVKGTRYFECPPLHGAMVRPDKVKVG 230 >gb|ADE77875.1| unknown [Picea sitchensis] Length = 242 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 334 KHDGMVKGKRYFECPPLCGAMVRPDKVQVG 245 KHDGMVKGKRYF CPPL G M+RPDKV+VG Sbjct: 200 KHDGMVKGKRYFSCPPLQGVMLRPDKVKVG 229 >gb|EPS70893.1| hypothetical protein M569_03866, partial [Genlisea aurea] Length = 160 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -3 Query: 334 KHDGMVKGKRYFECPPLCGAMVRPDKVQVG 245 KHDGMVKG RYFECPPL G MVRPDKV+ G Sbjct: 119 KHDGMVKGHRYFECPPLHGGMVRPDKVKAG 148 >ref|XP_002882657.1| tubulin folding cofactor B [Arabidopsis lyrata subsp. lyrata] gi|297328497|gb|EFH58916.1| tubulin folding cofactor B [Arabidopsis lyrata subsp. lyrata] Length = 243 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 334 KHDGMVKGKRYFECPPLCGAMVRPDKVQVG 245 KHDGMVKG R+FECPPL G MVRPDKV+VG Sbjct: 201 KHDGMVKGTRFFECPPLQGGMVRPDKVKVG 230 >ref|XP_007223788.1| hypothetical protein PRUPE_ppa010616mg [Prunus persica] gi|462420724|gb|EMJ24987.1| hypothetical protein PRUPE_ppa010616mg [Prunus persica] Length = 243 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -3 Query: 334 KHDGMVKGKRYFECPPLCGAMVRPDKVQVG 245 KHDGMVKG RYF CPPL G MVRPDKV+VG Sbjct: 201 KHDGMVKGTRYFNCPPLHGGMVRPDKVKVG 230 >ref|XP_006492512.1| PREDICTED: tubulin-folding cofactor B-like isoform X1 [Citrus sinensis] gi|568879095|ref|XP_006492513.1| PREDICTED: tubulin-folding cofactor B-like isoform X2 [Citrus sinensis] Length = 243 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 334 KHDGMVKGKRYFECPPLCGAMVRPDKVQVG 245 KH+G+VKG RYFECPPL GAMVRPDKV+VG Sbjct: 201 KHNGIVKGVRYFECPPLHGAMVRPDKVKVG 230 >ref|XP_006442070.1| hypothetical protein CICLE_v10021922mg [Citrus clementina] gi|567899166|ref|XP_006442071.1| hypothetical protein CICLE_v10021922mg [Citrus clementina] gi|557544332|gb|ESR55310.1| hypothetical protein CICLE_v10021922mg [Citrus clementina] gi|557544333|gb|ESR55311.1| hypothetical protein CICLE_v10021922mg [Citrus clementina] Length = 243 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 334 KHDGMVKGKRYFECPPLCGAMVRPDKVQVG 245 KH+G+VKG RYFECPPL GAMVRPDKV+VG Sbjct: 201 KHNGIVKGVRYFECPPLHGAMVRPDKVKVG 230 >ref|XP_004298196.1| PREDICTED: tubulin-specific chaperone B-like [Fragaria vesca subsp. vesca] Length = 157 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 334 KHDGMVKGKRYFECPPLCGAMVRPDKVQVG 245 KHDGMVKG RYF CPPL GA+VRPDK++VG Sbjct: 115 KHDGMVKGTRYFNCPPLHGAVVRPDKIKVG 144 >ref|XP_006298430.1| hypothetical protein CARUB_v10014499mg [Capsella rubella] gi|482567139|gb|EOA31328.1| hypothetical protein CARUB_v10014499mg [Capsella rubella] Length = 243 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 334 KHDGMVKGKRYFECPPLCGAMVRPDKVQVG 245 KHDGMVKG R+FECPPL G +VRPDKV+VG Sbjct: 201 KHDGMVKGTRFFECPPLQGGIVRPDKVKVG 230 >ref|XP_002529160.1| tubulin-specific chaperone B, putative [Ricinus communis] gi|223531384|gb|EEF33219.1| tubulin-specific chaperone B, putative [Ricinus communis] Length = 243 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -3 Query: 334 KHDGMVKGKRYFECPPLCGAMVRPDKVQVG 245 KHDG+VKG RYF+CPPL G M+RPDK++VG Sbjct: 201 KHDGLVKGVRYFDCPPLHGGMIRPDKIKVG 230 >ref|XP_006579371.1| PREDICTED: uncharacterized protein LOC100500664 isoform X1 [Glycine max] Length = 243 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 334 KHDGMVKGKRYFECPPLCGAMVRPDKVQVG 245 KHDGMVKG RYFECPP G MVRP+KV+VG Sbjct: 201 KHDGMVKGVRYFECPPSHGGMVRPEKVKVG 230 >ref|XP_004514584.1| PREDICTED: tubulin-specific chaperone B-like [Cicer arietinum] Length = 243 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -3 Query: 334 KHDGMVKGKRYFECPPLCGAMVRPDKVQVG 245 KHDGMVKG RYF+CPP G M+RPDKV+VG Sbjct: 201 KHDGMVKGVRYFQCPPSHGGMIRPDKVKVG 230 >ref|XP_002307984.1| tubulin folding cofactor B family protein [Populus trichocarpa] gi|118483420|gb|ABK93610.1| unknown [Populus trichocarpa] gi|222853960|gb|EEE91507.1| tubulin folding cofactor B family protein [Populus trichocarpa] Length = 243 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 334 KHDGMVKGKRYFECPPLCGAMVRPDKVQVG 245 KHDGMVKG RYF+ PPL GAM+RPDKV+VG Sbjct: 201 KHDGMVKGVRYFDSPPLHGAMIRPDKVKVG 230