BLASTX nr result
ID: Mentha27_contig00021935
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00021935 (389 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007210682.1| hypothetical protein PRUPE_ppb020315mg [Prun... 46 7e-07 gb|EXB45095.1| putative S-adenosylmethionine-dependent methyltra... 45 6e-06 >ref|XP_007210682.1| hypothetical protein PRUPE_ppb020315mg [Prunus persica] gi|462406417|gb|EMJ11881.1| hypothetical protein PRUPE_ppb020315mg [Prunus persica] Length = 351 Score = 45.8 bits (107), Expect(4) = 7e-07 Identities = 19/33 (57%), Positives = 26/33 (78%) Frame = -3 Query: 141 DLATFMSARADEIGNGGLLLLIVPGTPDGIPHS 43 D+ F+ ARA EI +GGL++LI+PG P+G PHS Sbjct: 183 DMECFLHARAQEIVHGGLMVLIIPGRPNGTPHS 215 Score = 27.3 bits (59), Expect(4) = 7e-07 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -2 Query: 322 LFISLPPETSYHTAGVLGSFHG 257 LF SLP Y+ AGV GSF G Sbjct: 102 LFKSLPQSRQYYAAGVPGSFCG 123 Score = 23.1 bits (48), Expect(4) = 7e-07 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 254 LFRSNSITVTHSSFSLHQLCK 192 +F + SI + HSS++LH L + Sbjct: 125 IFANASIHLVHSSYALHWLSR 145 Score = 20.4 bits (41), Expect(4) = 7e-07 Identities = 7/12 (58%), Positives = 11/12 (91%) Frame = -3 Query: 369 SSKTLEFQIFFS 334 +S+ LEFQ+FF+ Sbjct: 81 NSQILEFQVFFN 92 >gb|EXB45095.1| putative S-adenosylmethionine-dependent methyltransferase [Morus notabilis] Length = 349 Score = 44.7 bits (104), Expect(3) = 6e-06 Identities = 18/34 (52%), Positives = 26/34 (76%) Frame = -3 Query: 141 DLATFMSARADEIGNGGLLLLIVPGTPDGIPHSE 40 D+ F+ ARA+EI +GGL+ L+ PG P+G PHS+ Sbjct: 174 DMDNFLRARAEEIVDGGLMALVFPGRPNGTPHSQ 207 Score = 26.2 bits (56), Expect(3) = 6e-06 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 322 LFISLPPETSYHTAGVLGSFH 260 LF SL + Y AGV GSFH Sbjct: 103 LFTSLTGDKKYFVAGVPGSFH 123 Score = 23.9 bits (50), Expect(3) = 6e-06 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 254 LFRSNSITVTHSSFSLHQLCK 192 LF S S+ HSS++LH L K Sbjct: 126 LFPSASLHFVHSSYALHCLSK 146