BLASTX nr result
ID: Mentha27_contig00021919
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00021919 (216 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43911.1| hypothetical protein MIMGU_mgv1a016894mg [Mimulus... 95 9e-18 ref|XP_003609600.1| Monothiol glutaredoxin-S2 [Medicago truncatu... 95 9e-18 gb|EPS64180.1| hypothetical protein M569_10600 [Genlisea aurea] 94 3e-17 ref|XP_007154238.1| hypothetical protein PHAVU_003G102000g [Phas... 92 6e-17 gb|AFK45164.1| unknown [Lotus japonicus] 92 6e-17 ref|XP_006584039.1| PREDICTED: monothiol glutaredoxin-S2-like [G... 92 7e-17 ref|XP_004508301.1| PREDICTED: monothiol glutaredoxin-S2-like [C... 92 1e-16 gb|EXB74836.1| Monothiol glutaredoxin-S2 [Morus notabilis] 90 4e-16 ref|XP_004134195.1| PREDICTED: monothiol glutaredoxin-S2-like [C... 90 4e-16 ref|XP_003550174.1| PREDICTED: monothiol glutaredoxin-S2-like [G... 90 4e-16 ref|XP_007147880.1| hypothetical protein PHAVU_006G162700g [Phas... 89 6e-16 ref|XP_006414472.1| hypothetical protein EUTSA_v10027374mg [Eutr... 89 6e-16 ref|NP_197361.1| monothiol glutaredoxin-S2 [Arabidopsis thaliana... 89 6e-16 ref|NP_193303.1| monothiol glutaredoxin-S4 [Arabidopsis thaliana... 89 6e-16 gb|EYU43914.1| hypothetical protein MIMGU_mgv1a016876mg [Mimulus... 89 8e-16 ref|XP_006284821.1| hypothetical protein CARUB_v10006100mg [Caps... 89 8e-16 ref|XP_002870217.1| glutaredoxin family protein [Arabidopsis lyr... 89 8e-16 ref|XP_007035505.1| Thioredoxin superfamily protein [Theobroma c... 88 1e-15 ref|XP_004296808.1| PREDICTED: monothiol glutaredoxin-S2-like [F... 88 1e-15 ref|XP_004296807.1| PREDICTED: monothiol glutaredoxin-S2-like [F... 88 1e-15 >gb|EYU43911.1| hypothetical protein MIMGU_mgv1a016894mg [Mimulus guttatus] Length = 102 Score = 95.1 bits (235), Expect = 9e-18 Identities = 44/54 (81%), Positives = 49/54 (90%) Frame = -1 Query: 162 MDRVSNMVSERPVVVFSKSTCCMSHTIRSLFGDFGVNPTVYELDEISRGREVEQ 1 M+RVS MVSE+PVV+FS +TCCMSHTI SLF DFGVNP VYELDEISRGRE+EQ Sbjct: 1 MERVSKMVSEKPVVIFSMTTCCMSHTIISLFSDFGVNPMVYELDEISRGREIEQ 54 >ref|XP_003609600.1| Monothiol glutaredoxin-S2 [Medicago truncatula] gi|357478631|ref|XP_003609601.1| Monothiol glutaredoxin-S2 [Medicago truncatula] gi|357478633|ref|XP_003609602.1| Monothiol glutaredoxin-S2 [Medicago truncatula] gi|355510655|gb|AES91797.1| Monothiol glutaredoxin-S2 [Medicago truncatula] gi|355510656|gb|AES91798.1| Monothiol glutaredoxin-S2 [Medicago truncatula] gi|355510657|gb|AES91799.1| Monothiol glutaredoxin-S2 [Medicago truncatula] gi|388518675|gb|AFK47399.1| unknown [Medicago truncatula] Length = 103 Score = 95.1 bits (235), Expect = 9e-18 Identities = 43/54 (79%), Positives = 50/54 (92%) Frame = -1 Query: 162 MDRVSNMVSERPVVVFSKSTCCMSHTIRSLFGDFGVNPTVYELDEISRGREVEQ 1 M+RV+ MVSERPVV+FSKS+CCMSHTI++LF DFGVNP VYELDEI RGRE+EQ Sbjct: 1 MERVTKMVSERPVVIFSKSSCCMSHTIKTLFCDFGVNPAVYELDEIPRGREIEQ 54 >gb|EPS64180.1| hypothetical protein M569_10600 [Genlisea aurea] Length = 102 Score = 93.6 bits (231), Expect = 3e-17 Identities = 43/54 (79%), Positives = 50/54 (92%) Frame = -1 Query: 162 MDRVSNMVSERPVVVFSKSTCCMSHTIRSLFGDFGVNPTVYELDEISRGREVEQ 1 M+ VS MV+E+PVVVFSKS+CC+SHTIRSL DFGVNPTVYELDE++RGREVEQ Sbjct: 1 MEMVSKMVAEKPVVVFSKSSCCISHTIRSLLSDFGVNPTVYELDEMARGREVEQ 54 >ref|XP_007154238.1| hypothetical protein PHAVU_003G102000g [Phaseolus vulgaris] gi|561027592|gb|ESW26232.1| hypothetical protein PHAVU_003G102000g [Phaseolus vulgaris] Length = 102 Score = 92.4 bits (228), Expect = 6e-17 Identities = 41/54 (75%), Positives = 51/54 (94%) Frame = -1 Query: 162 MDRVSNMVSERPVVVFSKSTCCMSHTIRSLFGDFGVNPTVYELDEISRGREVEQ 1 MDRV+ MVSERPVV+FSKS+CCMSH+I++LF DFGVNP+V+ELDEI RGR++EQ Sbjct: 1 MDRVTKMVSERPVVIFSKSSCCMSHSIKTLFCDFGVNPSVHELDEIPRGRDIEQ 54 >gb|AFK45164.1| unknown [Lotus japonicus] Length = 103 Score = 92.4 bits (228), Expect = 6e-17 Identities = 41/54 (75%), Positives = 50/54 (92%) Frame = -1 Query: 162 MDRVSNMVSERPVVVFSKSTCCMSHTIRSLFGDFGVNPTVYELDEISRGREVEQ 1 M+RV+ MVSERPVV+FSKS+CCMSH+I++LF DFGVNP VYELDEI RGR++EQ Sbjct: 1 MERVTKMVSERPVVIFSKSSCCMSHSIKTLFCDFGVNPAVYELDEIPRGRDIEQ 54 >ref|XP_006584039.1| PREDICTED: monothiol glutaredoxin-S2-like [Glycine max] Length = 102 Score = 92.0 bits (227), Expect = 7e-17 Identities = 41/54 (75%), Positives = 50/54 (92%) Frame = -1 Query: 162 MDRVSNMVSERPVVVFSKSTCCMSHTIRSLFGDFGVNPTVYELDEISRGREVEQ 1 M+RV+ MVSERPVV+FSKS+CCMSHTI++LF DFGVNP V+ELDEI RGR++EQ Sbjct: 1 MERVTKMVSERPVVIFSKSSCCMSHTIKTLFCDFGVNPAVHELDEIPRGRDIEQ 54 >ref|XP_004508301.1| PREDICTED: monothiol glutaredoxin-S2-like [Cicer arietinum] gi|502151149|ref|XP_004508302.1| PREDICTED: monothiol glutaredoxin-S2-like [Cicer arietinum] Length = 102 Score = 91.7 bits (226), Expect = 1e-16 Identities = 40/54 (74%), Positives = 49/54 (90%) Frame = -1 Query: 162 MDRVSNMVSERPVVVFSKSTCCMSHTIRSLFGDFGVNPTVYELDEISRGREVEQ 1 M+R++ MVSERPVV+FSKSTCCMSHTI++L +FGVNP V+ELDEI RGRE+EQ Sbjct: 1 MERITKMVSERPVVIFSKSTCCMSHTIKTLLSEFGVNPAVHELDEIPRGREIEQ 54 >gb|EXB74836.1| Monothiol glutaredoxin-S2 [Morus notabilis] Length = 102 Score = 89.7 bits (221), Expect = 4e-16 Identities = 40/54 (74%), Positives = 48/54 (88%) Frame = -1 Query: 162 MDRVSNMVSERPVVVFSKSTCCMSHTIRSLFGDFGVNPTVYELDEISRGREVEQ 1 M+RV+ MVSE+PVV+FS+STCCM HTI++LF DFGVNP VYELDE RGRE+EQ Sbjct: 1 MERVTKMVSEKPVVIFSRSTCCMCHTIKTLFCDFGVNPAVYELDEEPRGREIEQ 54 >ref|XP_004134195.1| PREDICTED: monothiol glutaredoxin-S2-like [Cucumis sativus] gi|449526069|ref|XP_004170037.1| PREDICTED: monothiol glutaredoxin-S2-like [Cucumis sativus] Length = 102 Score = 89.7 bits (221), Expect = 4e-16 Identities = 40/54 (74%), Positives = 47/54 (87%) Frame = -1 Query: 162 MDRVSNMVSERPVVVFSKSTCCMSHTIRSLFGDFGVNPTVYELDEISRGREVEQ 1 MDRV+ ++SERPVV+FSKSTCCMSHT+ L FGVNP V+ELD+ISRGREVEQ Sbjct: 1 MDRVTRLISERPVVIFSKSTCCMSHTVMRLLSGFGVNPAVHELDQISRGREVEQ 54 >ref|XP_003550174.1| PREDICTED: monothiol glutaredoxin-S2-like [Glycine max] Length = 102 Score = 89.7 bits (221), Expect = 4e-16 Identities = 40/54 (74%), Positives = 49/54 (90%) Frame = -1 Query: 162 MDRVSNMVSERPVVVFSKSTCCMSHTIRSLFGDFGVNPTVYELDEISRGREVEQ 1 M+RV+ MVSERPVV+FSKS+CCMSHTI++L DFGVNP V+ELDEI RGR++EQ Sbjct: 1 MERVTKMVSERPVVIFSKSSCCMSHTIKTLLCDFGVNPAVHELDEIPRGRDIEQ 54 >ref|XP_007147880.1| hypothetical protein PHAVU_006G162700g [Phaseolus vulgaris] gi|561021103|gb|ESW19874.1| hypothetical protein PHAVU_006G162700g [Phaseolus vulgaris] Length = 102 Score = 89.0 bits (219), Expect = 6e-16 Identities = 39/54 (72%), Positives = 47/54 (87%) Frame = -1 Query: 162 MDRVSNMVSERPVVVFSKSTCCMSHTIRSLFGDFGVNPTVYELDEISRGREVEQ 1 MDRV M SERPVV+FS+S+CCM HTI++LF DFGVNP V+ELDEI RGR++EQ Sbjct: 1 MDRVVQMASERPVVIFSRSSCCMCHTIKTLFNDFGVNPNVHELDEIPRGRDIEQ 54 >ref|XP_006414472.1| hypothetical protein EUTSA_v10027374mg [Eutrema salsugineum] gi|557115642|gb|ESQ55925.1| hypothetical protein EUTSA_v10027374mg [Eutrema salsugineum] Length = 102 Score = 89.0 bits (219), Expect = 6e-16 Identities = 37/54 (68%), Positives = 50/54 (92%) Frame = -1 Query: 162 MDRVSNMVSERPVVVFSKSTCCMSHTIRSLFGDFGVNPTVYELDEISRGREVEQ 1 MD++ M+SE+ VV+FSK++CCMSHTI++LF DFGVNPT+YELDEI+RG+E+EQ Sbjct: 1 MDKLQKMISEKSVVIFSKNSCCMSHTIKTLFLDFGVNPTIYELDEINRGKEIEQ 54 >ref|NP_197361.1| monothiol glutaredoxin-S2 [Arabidopsis thaliana] gi|75154460|sp|Q8L8Z8.1|GRXS2_ARATH RecName: Full=Monothiol glutaredoxin-S2; Short=AtGrxS2; AltName: Full=Protein ROXY 10 gi|21617983|gb|AAM67033.1| glutaredoxin-like protein [Arabidopsis thaliana] gi|26450155|dbj|BAC42196.1| putative glutaredoxin [Arabidopsis thaliana] gi|28827410|gb|AAO50549.1| putative glutaredoxin [Arabidopsis thaliana] gi|226348198|gb|ACO50415.1| glutaredoxin [Arabidopsis thaliana] gi|332005201|gb|AED92584.1| monothiol glutaredoxin-S2 [Arabidopsis thaliana] Length = 102 Score = 89.0 bits (219), Expect = 6e-16 Identities = 39/54 (72%), Positives = 47/54 (87%) Frame = -1 Query: 162 MDRVSNMVSERPVVVFSKSTCCMSHTIRSLFGDFGVNPTVYELDEISRGREVEQ 1 MD ++ MV ERPVV++SKS+CCMSHTI++L DFG NP VYELDEISRGRE+EQ Sbjct: 1 MDMITKMVMERPVVIYSKSSCCMSHTIKTLLCDFGANPAVYELDEISRGREIEQ 54 >ref|NP_193303.1| monothiol glutaredoxin-S4 [Arabidopsis thaliana] gi|297804672|ref|XP_002870220.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata] gi|75097840|sp|O23419.1|GRXS4_ARATH RecName: Full=Monothiol glutaredoxin-S4; Short=AtGrxS4; AltName: Full=Protein ROXY 13 gi|2244924|emb|CAB10346.1| glutaredoxin [Arabidopsis thaliana] gi|7268316|emb|CAB78610.1| glutaredoxin [Arabidopsis thaliana] gi|21592753|gb|AAM64702.1| glutaredoxin [Arabidopsis thaliana] gi|88900356|gb|ABD57490.1| At4g15680 [Arabidopsis thaliana] gi|226348204|gb|ACO50418.1| glutaredoxin [Arabidopsis thaliana] gi|297316056|gb|EFH46479.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata] gi|332658235|gb|AEE83635.1| monothiol glutaredoxin-S4 [Arabidopsis thaliana] Length = 102 Score = 89.0 bits (219), Expect = 6e-16 Identities = 37/54 (68%), Positives = 50/54 (92%) Frame = -1 Query: 162 MDRVSNMVSERPVVVFSKSTCCMSHTIRSLFGDFGVNPTVYELDEISRGREVEQ 1 MD++ M+SE+ VV+FSK++CCMSHTI++LF DFGVNPT+YELDEI+RG+E+EQ Sbjct: 1 MDKLQKMISEKSVVIFSKNSCCMSHTIKTLFIDFGVNPTIYELDEINRGKEIEQ 54 >gb|EYU43914.1| hypothetical protein MIMGU_mgv1a016876mg [Mimulus guttatus] Length = 103 Score = 88.6 bits (218), Expect = 8e-16 Identities = 37/54 (68%), Positives = 50/54 (92%) Frame = -1 Query: 162 MDRVSNMVSERPVVVFSKSTCCMSHTIRSLFGDFGVNPTVYELDEISRGREVEQ 1 M+R++ +VS++P+V+FS +TCCMSHTI+SLF DFGVNPT+YELDEI+ GRE+EQ Sbjct: 1 MERLNKLVSKKPLVIFSMTTCCMSHTIKSLFYDFGVNPTIYELDEIANGREIEQ 54 >ref|XP_006284821.1| hypothetical protein CARUB_v10006100mg [Capsella rubella] gi|482553526|gb|EOA17719.1| hypothetical protein CARUB_v10006100mg [Capsella rubella] Length = 102 Score = 88.6 bits (218), Expect = 8e-16 Identities = 36/54 (66%), Positives = 50/54 (92%) Frame = -1 Query: 162 MDRVSNMVSERPVVVFSKSTCCMSHTIRSLFGDFGVNPTVYELDEISRGREVEQ 1 MD++ M+SE+ VV+FSK++CCMSHT+++LF DFGVNPT+YELDEI+RG+E+EQ Sbjct: 1 MDKLQKMISEKSVVIFSKNSCCMSHTVKTLFIDFGVNPTIYELDEINRGKEIEQ 54 >ref|XP_002870217.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata] gi|297316053|gb|EFH46476.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata] Length = 102 Score = 88.6 bits (218), Expect = 8e-16 Identities = 37/54 (68%), Positives = 50/54 (92%) Frame = -1 Query: 162 MDRVSNMVSERPVVVFSKSTCCMSHTIRSLFGDFGVNPTVYELDEISRGREVEQ 1 M+++ MV E+PVV+FSK++CCMSHTI++LF DFGVNPT+YELDEI+RG+E+EQ Sbjct: 1 MEKLQTMVYEKPVVIFSKNSCCMSHTIKTLFLDFGVNPTIYELDEINRGKEIEQ 54 >ref|XP_007035505.1| Thioredoxin superfamily protein [Theobroma cacao] gi|508714534|gb|EOY06431.1| Thioredoxin superfamily protein [Theobroma cacao] Length = 102 Score = 88.2 bits (217), Expect = 1e-15 Identities = 38/54 (70%), Positives = 49/54 (90%) Frame = -1 Query: 162 MDRVSNMVSERPVVVFSKSTCCMSHTIRSLFGDFGVNPTVYELDEISRGREVEQ 1 M+RV+ + SE+PVV+FSKS+CCM HTI++LF DFGVNP V+ELDEI+RGRE+EQ Sbjct: 1 MERVTKLASEKPVVIFSKSSCCMCHTIKTLFYDFGVNPAVHELDEIARGREIEQ 54 >ref|XP_004296808.1| PREDICTED: monothiol glutaredoxin-S2-like [Fragaria vesca subsp. vesca] Length = 102 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/54 (70%), Positives = 47/54 (87%) Frame = -1 Query: 162 MDRVSNMVSERPVVVFSKSTCCMSHTIRSLFGDFGVNPTVYELDEISRGREVEQ 1 M+ V+ M SERPVV+FSKS+CCMSH+I++L DFGVNP VYELDE+ RGRE+EQ Sbjct: 1 MEAVTKMASERPVVIFSKSSCCMSHSIKTLLSDFGVNPAVYELDEMQRGREIEQ 54 >ref|XP_004296807.1| PREDICTED: monothiol glutaredoxin-S2-like [Fragaria vesca subsp. vesca] Length = 102 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/54 (70%), Positives = 47/54 (87%) Frame = -1 Query: 162 MDRVSNMVSERPVVVFSKSTCCMSHTIRSLFGDFGVNPTVYELDEISRGREVEQ 1 M+ V+ M SERPVV+FSKS+CCMSH+I++L DFGVNP VYELDE+ RGRE+EQ Sbjct: 1 MEAVTKMASERPVVIFSKSSCCMSHSIKTLLSDFGVNPAVYELDEMQRGREIEQ 54