BLASTX nr result
ID: Mentha27_contig00020962
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00020962 (200 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45578.1| hypothetical protein MIMGU_mgv1a007199mg [Mimulus... 86 5e-15 gb|EYU43901.1| hypothetical protein MIMGU_mgv1a020989mg [Mimulus... 61 2e-07 gb|EYU43900.1| hypothetical protein MIMGU_mgv1a026213mg [Mimulus... 61 2e-07 dbj|BAM28984.1| UDP-glucose glucosyltransferase [Gardenia jasmin... 57 3e-06 >gb|EYU45578.1| hypothetical protein MIMGU_mgv1a007199mg [Mimulus guttatus] Length = 415 Score = 85.9 bits (211), Expect = 5e-15 Identities = 39/64 (60%), Positives = 52/64 (81%), Gaps = 1/64 (1%) Frame = -1 Query: 191 FPFEEMSLREFEKKGLVASGESLKVKGVEEGFGFGIFKLSCDVVLTKS-CRGVEGKYLDY 15 FPF + LR+FEK+ L++ GES++V+ EEGF FGIF+LSCD+VL KS CR +EGKY+DY Sbjct: 162 FPFPSIFLRDFEKRNLISRGESIEVQDKEEGFAFGIFELSCDIVLVKSCCREIEGKYMDY 221 Query: 14 LSSL 3 S+L Sbjct: 222 FSTL 225 >gb|EYU43901.1| hypothetical protein MIMGU_mgv1a020989mg [Mimulus guttatus] Length = 467 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/63 (49%), Positives = 44/63 (69%) Frame = -1 Query: 191 FPFEEMSLREFEKKGLVASGESLKVKGVEEGFGFGIFKLSCDVVLTKSCRGVEGKYLDYL 12 FP++E+ L + EK L A + ++K ++ F FG FKLSCD+VL KS +G+E KY+DYL Sbjct: 170 FPYQEIYLSDREKADLNAV-VAPEIKDADQDFAFGNFKLSCDIVLIKSSKGLEQKYIDYL 228 Query: 11 SSL 3 S L Sbjct: 229 SVL 231 >gb|EYU43900.1| hypothetical protein MIMGU_mgv1a026213mg [Mimulus guttatus] Length = 454 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/63 (46%), Positives = 43/63 (68%) Frame = -1 Query: 191 FPFEEMSLREFEKKGLVASGESLKVKGVEEGFGFGIFKLSCDVVLTKSCRGVEGKYLDYL 12 FP++ + LR++E+K L + S ++ F FG F +SC++VL K+C G+EGKYLDYL Sbjct: 160 FPYDGIYLRDYERKALQSMVLSRDKN--DQDFAFGHFSMSCEIVLMKTCNGLEGKYLDYL 217 Query: 11 SSL 3 S L Sbjct: 218 SVL 220 >dbj|BAM28984.1| UDP-glucose glucosyltransferase [Gardenia jasminoides] Length = 454 Score = 57.0 bits (136), Expect = 3e-06 Identities = 31/63 (49%), Positives = 41/63 (65%) Frame = -1 Query: 191 FPFEEMSLREFEKKGLVASGESLKVKGVEEGFGFGIFKLSCDVVLTKSCRGVEGKYLDYL 12 FPF E+ R++E+ + ES + GV E F F F+LS ++VL KSC G+E KYLDYL Sbjct: 167 FPFSEIFQRDYERDKFESLVESNR--GVAEDFAFRSFELSSEIVLMKSCIGLEDKYLDYL 224 Query: 11 SSL 3 S L Sbjct: 225 SFL 227