BLASTX nr result
ID: Mentha27_contig00020872
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00020872 (296 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31800.1| hypothetical protein MIMGU_mgv1a000153mg [Mimulus... 64 2e-08 >gb|EYU31800.1| hypothetical protein MIMGU_mgv1a000153mg [Mimulus guttatus] Length = 1592 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 294 EFYGEPRARKKDASETAAEAALWCLGNEGYAWDRKRD 184 EFYGEPRARKKDA+E AAE ALW L +EGY WD+KR+ Sbjct: 1555 EFYGEPRARKKDAAEHAAEGALWYLKHEGYIWDKKRN 1591