BLASTX nr result
ID: Mentha27_contig00020775
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00020775 (459 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41213.1| hypothetical protein MIMGU_mgv1a000333mg [Mimulus... 70 2e-10 >gb|EYU41213.1| hypothetical protein MIMGU_mgv1a000333mg [Mimulus guttatus] Length = 1248 Score = 70.5 bits (171), Expect = 2e-10 Identities = 37/56 (66%), Positives = 44/56 (78%) Frame = +3 Query: 288 MAETEVSKEVSKMVAIEEKCGLDMSSYQDLPKPDSNGSNHHNQANDLDNSYVFVTG 455 MAETEVS EVS +V IEEKC +MSS +DLPKPDSNG+ +DL+NSYVFV+G Sbjct: 1 MAETEVSTEVSNVVGIEEKCLSEMSSCKDLPKPDSNGT------SDLENSYVFVSG 50