BLASTX nr result
ID: Mentha27_contig00020759
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00020759 (395 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22530.1| hypothetical protein MIMGU_mgv1a011936mg [Mimulus... 67 3e-09 >gb|EYU22530.1| hypothetical protein MIMGU_mgv1a011936mg [Mimulus guttatus] Length = 266 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/48 (62%), Positives = 33/48 (68%), Gaps = 6/48 (12%) Frame = +1 Query: 1 VYPIIGEKAAGKLPHKYVYQY------HSHSHGNSGHVFVVQKGNHWQ 126 +YPI GEKAAGK+P KY YQY H H HGN GHVFVV G+H Q Sbjct: 219 MYPITGEKAAGKIPQKYAYQYQFHQYHHHHGHGNGGHVFVVHNGSHCQ 266