BLASTX nr result
ID: Mentha27_contig00020752
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00020752 (268 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29781.1| hypothetical protein MIMGU_mgv1a007558mg [Mimulus... 74 2e-11 >gb|EYU29781.1| hypothetical protein MIMGU_mgv1a007558mg [Mimulus guttatus] Length = 403 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -3 Query: 266 DEKLIFPERVNIHEFIMPKESISFGDYTEKVLDKYYDLDA 147 DEKLIFPE +NIHEFI P SISFGDYTEKVLDKYYDL+A Sbjct: 364 DEKLIFPELINIHEFITPNGSISFGDYTEKVLDKYYDLNA 403