BLASTX nr result
ID: Mentha27_contig00020739
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00020739 (447 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38994.1| hypothetical protein MIMGU_mgv1a025975mg [Mimulus... 61 1e-07 >gb|EYU38994.1| hypothetical protein MIMGU_mgv1a025975mg [Mimulus guttatus] Length = 207 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +2 Query: 68 LAEGVLMSPPPYMGWRFSWDDVESDAELDLELW 166 LAEGVL+SPPP +GWRFSWDDVESDA D+ELW Sbjct: 175 LAEGVLLSPPPCLGWRFSWDDVESDA--DMELW 205