BLASTX nr result
ID: Mentha27_contig00020423
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00020423 (481 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS69618.1| hypothetical protein M569_05151 [Genlisea aurea] 65 1e-08 ref|XP_002530136.1| 60S ribosomal protein L18a, plant, putative ... 63 4e-08 gb|ADR71269.1| 60S ribosomal protein L18aA [Hevea brasiliensis] 62 6e-08 ref|XP_002268796.1| PREDICTED: 60S ribosomal protein L18a-1 [Vit... 62 1e-07 gb|AAM63092.1| unknown [Arabidopsis thaliana] 61 1e-07 gb|ADR71270.1| 60S ribosomal protein L18aB [Hevea brasiliensis] 60 2e-07 ref|NP_564634.1| ribosomal protein L18ae family [Arabidopsis tha... 60 4e-07 gb|EXC29379.1| 60S ribosomal protein L18a-1 [Morus notabilis] 59 5e-07 gb|EXB52092.1| 60S ribosomal protein L18a-1 [Morus notabilis] 59 5e-07 ref|XP_004488664.1| PREDICTED: 60S ribosomal protein L18a-1-like... 59 5e-07 ref|XP_004146004.1| PREDICTED: 60S ribosomal protein L18a-1-like... 59 5e-07 ref|XP_006645697.1| PREDICTED: 60S ribosomal protein L18a-like p... 59 7e-07 ref|XP_006349990.1| PREDICTED: 60S ribosomal protein L18a-like p... 59 7e-07 dbj|BAK01175.1| predicted protein [Hordeum vulgare subsp. vulgare] 59 7e-07 ref|XP_002298923.1| hypothetical protein POPTR_0001s38920g [Popu... 59 7e-07 ref|NP_001042559.1| Os01g0242900 [Oryza sativa Japonica Group] g... 59 7e-07 ref|XP_003546755.1| PREDICTED: 60S ribosomal protein L18a-like p... 59 9e-07 gb|ABU98949.1| unknown [Lupinus albus] 59 9e-07 ref|XP_006477943.1| PREDICTED: 60S ribosomal protein L18a-like p... 58 1e-06 ref|XP_006442291.1| hypothetical protein CICLE_v10022163mg [Citr... 58 1e-06 >gb|EPS69618.1| hypothetical protein M569_05151 [Genlisea aurea] Length = 149 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -1 Query: 481 AAFLLLCSRIDPREKPGYVACMIAAVLATIAFVFGMTRID 362 AA +L+CSR+D REKPGY+AC IAA LATIA +FG+TRID Sbjct: 109 AALILVCSRVDIREKPGYIACSIAAGLATIAIIFGLTRID 148 >ref|XP_002530136.1| 60S ribosomal protein L18a, plant, putative [Ricinus communis] gi|223530361|gb|EEF32252.1| 60S ribosomal protein L18a, plant, putative [Ricinus communis] Length = 166 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -1 Query: 475 FLLLCSRIDPREKPGYVACMIAAVLATIAFVFGMTR 368 F+LLC+RIDPREKPGYVAC IAAVLATIA V G T+ Sbjct: 126 FILLCARIDPREKPGYVACTIAAVLATIAIVLGATK 161 >gb|ADR71269.1| 60S ribosomal protein L18aA [Hevea brasiliensis] Length = 151 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = -1 Query: 475 FLLLCSRIDPREKPGYVACMIAAVLATIAFVFGMTR 368 F+LLC+RIDPREKPGY+AC IAAVLAT+A + G+T+ Sbjct: 112 FVLLCARIDPREKPGYIACTIAAVLATVAIILGVTK 147 >ref|XP_002268796.1| PREDICTED: 60S ribosomal protein L18a-1 [Vitis vinifera] gi|296082825|emb|CBI22126.3| unnamed protein product [Vitis vinifera] Length = 143 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = -1 Query: 475 FLLLCSRIDPREKPGYVACMIAAVLATIAFVFGMTR 368 FLLLC+R+D REKPGY+AC IAA+LATIA +FG+T+ Sbjct: 104 FLLLCARVDYREKPGYIACTIAAILATIAIIFGVTK 139 >gb|AAM63092.1| unknown [Arabidopsis thaliana] Length = 153 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -1 Query: 475 FLLLCSRIDPREKPGYVACMIAAVLATIAFVFGM 374 F+L+C+RIDPREKPGYVAC IAAV+ATIA VFG+ Sbjct: 112 FILVCARIDPREKPGYVACTIAAVVATIAIVFGV 145 >gb|ADR71270.1| 60S ribosomal protein L18aB [Hevea brasiliensis] Length = 158 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -1 Query: 475 FLLLCSRIDPREKPGYVACMIAAVLATIAFVFGMTR 368 F+LLC+RIDPREKPGY+AC IAAV+AT+A + G T+ Sbjct: 118 FVLLCARIDPREKPGYIACTIAAVVATVAIILGATK 153 >ref|NP_564634.1| ribosomal protein L18ae family [Arabidopsis thaliana] gi|8671871|gb|AAF78434.1|AC018748_13 Contains similarity to swi4 protein from Schizosaccharomyces pombe gi|1076927 [Arabidopsis thaliana] gi|12324020|gb|AAG51969.1|AC024260_7 hypothetical protein; 86225-87277 [Arabidopsis thaliana] gi|20466666|gb|AAM20650.1| unknown protein [Arabidopsis thaliana] gi|30102872|gb|AAP21354.1| At1g53560 [Arabidopsis thaliana] gi|332194838|gb|AEE32959.1| ribosomal protein L18ae family [Arabidopsis thaliana] Length = 153 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 475 FLLLCSRIDPREKPGYVACMIAAVLATIAFVFGM 374 F+L+C+RIDPREKPGYVAC IAAV+ATI VFG+ Sbjct: 112 FILVCARIDPREKPGYVACTIAAVVATITIVFGV 145 >gb|EXC29379.1| 60S ribosomal protein L18a-1 [Morus notabilis] Length = 241 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/47 (63%), Positives = 34/47 (72%) Frame = -1 Query: 478 AFLLLCSRIDPREKPGYVACMIAAVLATIAFVFGMTRIDD*RRKGTH 338 AF+LLC R+D REKPGYVACMIAA+LA IA G+T KGTH Sbjct: 128 AFILLCVRVDYREKPGYVACMIAAILAIIAVTLGVT-------KGTH 167 >gb|EXB52092.1| 60S ribosomal protein L18a-1 [Morus notabilis] Length = 160 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -1 Query: 478 AFLLLCSRIDPREKPGYVACMIAAVLATIAFVFGMTR 368 A +LLCSRID REKPGY+AC +AA+LATIA V G+T+ Sbjct: 119 ALILLCSRIDYREKPGYIACTVAAILATIAIVLGVTK 155 >ref|XP_004488664.1| PREDICTED: 60S ribosomal protein L18a-1-like [Cicer arietinum] Length = 154 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = -1 Query: 478 AFLLLCSRIDPREKPGYVACMIAAVLATIAFVFGMTRIDD 359 A ++LCSR+D REKPGY+AC++AAV+ATIA V G T + D Sbjct: 113 AIIMLCSRVDYREKPGYIACIVAAVVATIAIVLGATNVAD 152 >ref|XP_004146004.1| PREDICTED: 60S ribosomal protein L18a-1-like [Cucumis sativus] gi|449524020|ref|XP_004169021.1| PREDICTED: 60S ribosomal protein L18a-1-like [Cucumis sativus] Length = 153 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -1 Query: 478 AFLLLCSRIDPREKPGYVACMIAAVLATIAFVFGMTRIDD 359 A L++C R+D REKPGYVAC IAAV+AT+A +FG TR D Sbjct: 112 AILIICGRVDYREKPGYVACSIAAVIATVAIIFGATREAD 151 >ref|XP_006645697.1| PREDICTED: 60S ribosomal protein L18a-like protein-like, partial [Oryza brachyantha] Length = 93 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -1 Query: 478 AFLLLCSRIDPREKPGYVACMIAAVLATIAFVFGMT 371 AFLL CSR+D REKPGYVAC IAAVLATIA + G T Sbjct: 54 AFLLWCSRVDYREKPGYVACTIAAVLATIAIIIGAT 89 >ref|XP_006349990.1| PREDICTED: 60S ribosomal protein L18a-like protein-like [Solanum tuberosum] Length = 164 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -1 Query: 481 AAFLLLCSRIDPREKPGYVACMIAAVLATIAFVFGMTR 368 AAF+LLC++IDPREKPGY+A IAAVLAT VFG+++ Sbjct: 126 AAFVLLCAQIDPREKPGYIASTIAAVLATFVLVFGLSK 163 >dbj|BAK01175.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 159 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -1 Query: 478 AFLLLCSRIDPREKPGYVACMIAAVLATIAFVFGMT 371 AFLL CSR+D REKPGYVAC +AAVLATIA V G T Sbjct: 118 AFLLWCSRVDYREKPGYVACTVAAVLATIAIVIGAT 153 >ref|XP_002298923.1| hypothetical protein POPTR_0001s38920g [Populus trichocarpa] gi|118486768|gb|ABK95219.1| unknown [Populus trichocarpa] gi|222846181|gb|EEE83728.1| hypothetical protein POPTR_0001s38920g [Populus trichocarpa] Length = 156 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -1 Query: 475 FLLLCSRIDPREKPGYVACMIAAVLATIAFVFGMTR 368 F++ C RIDPREKPGYVAC IAA+LATIA + G T+ Sbjct: 116 FIIACMRIDPREKPGYVACTIAAILATIAIILGATK 151 >ref|NP_001042559.1| Os01g0242900 [Oryza sativa Japonica Group] gi|56784584|dbj|BAD81631.1| unknown protein [Oryza sativa Japonica Group] gi|113532090|dbj|BAF04473.1| Os01g0242900 [Oryza sativa Japonica Group] gi|215701188|dbj|BAG92612.1| unnamed protein product [Oryza sativa Japonica Group] gi|222618084|gb|EEE54216.1| hypothetical protein OsJ_01071 [Oryza sativa Japonica Group] Length = 156 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -1 Query: 478 AFLLLCSRIDPREKPGYVACMIAAVLATIAFVFGMT 371 AFLL CSR+D REKPGYVAC IAAVLATIA + G T Sbjct: 117 AFLLWCSRVDYREKPGYVACAIAAVLATIAIIIGAT 152 >ref|XP_003546755.1| PREDICTED: 60S ribosomal protein L18a-like protein-like [Glycine max] Length = 161 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/41 (60%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = -1 Query: 478 AFLLLCSRIDPREKPGYVACMIAAVLATIAFVFGMTR-IDD 359 A ++LCSR+D REKPGY+AC++AAVL TIA + G+T+ +DD Sbjct: 120 AIIMLCSRVDYREKPGYIACVVAAVLGTIAIILGVTKGVDD 160 >gb|ABU98949.1| unknown [Lupinus albus] Length = 163 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -1 Query: 478 AFLLLCSRIDPREKPGYVACMIAAVLATIAFVFGMTRIDD 359 A L+LCSR+D REKPGYVAC++AAVL IA +FG+T+ D Sbjct: 123 AILMLCSRVDYREKPGYVACIVAAVLYAIAIIFGVTKGGD 162 >ref|XP_006477943.1| PREDICTED: 60S ribosomal protein L18a-like protein-like [Citrus sinensis] Length = 210 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -1 Query: 475 FLLLCSRIDPREKPGYVACMIAAVLATIAFVFGMTR 368 F+L+C+RID REKPGY+AC IAAVLATIA + G+T+ Sbjct: 170 FVLMCARIDIREKPGYIACTIAAVLATIAIILGVTK 205 >ref|XP_006442291.1| hypothetical protein CICLE_v10022163mg [Citrus clementina] gi|557544553|gb|ESR55531.1| hypothetical protein CICLE_v10022163mg [Citrus clementina] Length = 210 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -1 Query: 475 FLLLCSRIDPREKPGYVACMIAAVLATIAFVFGMTR 368 F+L+C+RID REKPGY+AC IAAVLATIA + G+T+ Sbjct: 170 FVLMCARIDIREKPGYIACTIAAVLATIAIILGVTK 205