BLASTX nr result
ID: Mentha27_contig00020264
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00020264 (465 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006359583.1| PREDICTED: uncharacterized protein LOC102587... 55 8e-06 ref|XP_004228368.1| PREDICTED: uncharacterized protein LOC101245... 55 8e-06 >ref|XP_006359583.1| PREDICTED: uncharacterized protein LOC102587208 [Solanum tuberosum] Length = 363 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -3 Query: 463 MMSTVFYFSCKSFRLESASAEKEPVLEAQDIGLRSAEVQ*H 341 MMSTVFYFSCKS+R+E++S E +PVLEA I AEVQ H Sbjct: 322 MMSTVFYFSCKSYRMETSSEETQPVLEALTISSAFAEVQSH 362 >ref|XP_004228368.1| PREDICTED: uncharacterized protein LOC101245192 [Solanum lycopersicum] Length = 363 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -3 Query: 463 MMSTVFYFSCKSFRLESASAEKEPVLEAQDIGLRSAEVQ*H 341 MMSTVFYFSCKS+R+E++S E +PVLEA I AEVQ H Sbjct: 322 MMSTVFYFSCKSYRMETSSEETQPVLEALTISSALAEVQSH 362