BLASTX nr result
ID: Mentha27_contig00020021
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00020021 (257 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37664.1| hypothetical protein MIMGU_mgv1a005240mg [Mimulus... 55 8e-06 >gb|EYU37664.1| hypothetical protein MIMGU_mgv1a005240mg [Mimulus guttatus] Length = 492 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -2 Query: 109 QRMTSNPNQHQNQSSLHGNVAILWDIENCPVPSDVR 2 Q T N N +QN++SL G VAILWDIENCPVPSDVR Sbjct: 23 QISTPNRNINQNRTSLQGPVAILWDIENCPVPSDVR 58