BLASTX nr result
ID: Mentha27_contig00019950
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00019950 (418 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18475.1| hypothetical protein MIMGU_mgv1a020842mg [Mimulus... 71 2e-10 ref|XP_006493887.1| PREDICTED: outer envelope protein 64, mitoch... 69 5e-10 ref|XP_002268888.1| PREDICTED: outer envelope protein 64, mitoch... 69 5e-10 ref|XP_007042951.1| Translocon at the outer membrane of chloropl... 69 7e-10 ref|XP_002298203.2| chloroplast outer membrane translocon subuni... 68 2e-09 ref|XP_004136877.1| PREDICTED: outer envelope protein 64, mitoch... 68 2e-09 ref|XP_006341842.1| PREDICTED: outer envelope protein 64, mitoch... 67 3e-09 ref|XP_004248799.1| PREDICTED: outer envelope protein 64, mitoch... 67 3e-09 ref|XP_007200962.1| hypothetical protein PRUPE_ppa003071mg [Prun... 67 3e-09 gb|EPS65438.1| hypothetical protein M569_09339, partial [Genlise... 66 4e-09 ref|XP_003524732.1| PREDICTED: outer envelope protein 64, mitoch... 65 1e-08 ref|XP_004504805.1| PREDICTED: LOW QUALITY PROTEIN: outer envelo... 64 2e-08 ref|XP_002525865.1| amidase, putative [Ricinus communis] gi|2235... 64 2e-08 ref|XP_006286476.1| hypothetical protein CARUB_v10000509mg [Caps... 63 4e-08 ref|XP_007159113.1| hypothetical protein PHAVU_002G209800g [Phas... 63 5e-08 ref|XP_003531546.1| PREDICTED: outer envelope protein 64, mitoch... 61 1e-07 ref|XP_006597351.1| PREDICTED: outer envelope protein 64, mitoch... 61 2e-07 ref|XP_006597350.1| PREDICTED: outer envelope protein 64, mitoch... 61 2e-07 ref|XP_006399420.1| hypothetical protein EUTSA_v10013019mg [Eutr... 61 2e-07 ref|NP_196504.2| translocon at the outer membrane of chloroplast... 60 2e-07 >gb|EYU18475.1| hypothetical protein MIMGU_mgv1a020842mg [Mimulus guttatus] Length = 602 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -2 Query: 417 GTAKESLFFYKEAHQDFKHALVLEPQNKVASLVEKRLRKLI 295 GTA+ES+ FYKEA QDFKHALVLEPQN+VA L EKRLRKLI Sbjct: 561 GTARESMLFYKEALQDFKHALVLEPQNRVAGLAEKRLRKLI 601 >ref|XP_006493887.1| PREDICTED: outer envelope protein 64, mitochondrial-like [Citrus sinensis] Length = 605 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -2 Query: 417 GTAKESLFFYKEAHQDFKHALVLEPQNKVASLVEKRLRKLIG 292 GTA+E+LF Y EA QDFKHA+VLEPQNK A+L EKRLRKLIG Sbjct: 564 GTAREALFCYNEALQDFKHAMVLEPQNKAANLAEKRLRKLIG 605 >ref|XP_002268888.1| PREDICTED: outer envelope protein 64, mitochondrial [Vitis vinifera] gi|296086830|emb|CBI32979.3| unnamed protein product [Vitis vinifera] Length = 607 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -2 Query: 417 GTAKESLFFYKEAHQDFKHALVLEPQNKVASLVEKRLRKLI 295 GTA+ESL YKEA QDFKHALVLEPQNKVA+L EKRLRKL+ Sbjct: 566 GTARESLLCYKEAAQDFKHALVLEPQNKVANLAEKRLRKLM 606 >ref|XP_007042951.1| Translocon at the outer membrane of chloroplasts 64-V isoform 1 [Theobroma cacao] gi|508706886|gb|EOX98782.1| Translocon at the outer membrane of chloroplasts 64-V isoform 1 [Theobroma cacao] Length = 606 Score = 68.9 bits (167), Expect = 7e-10 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -2 Query: 417 GTAKESLFFYKEAHQDFKHALVLEPQNKVASLVEKRLRKLI 295 GTA+ESL YKEA +DFKHALVLEPQNKVA+L EKRLRKLI Sbjct: 565 GTARESLLCYKEALEDFKHALVLEPQNKVANLAEKRLRKLI 605 >ref|XP_002298203.2| chloroplast outer membrane translocon subunit family protein [Populus trichocarpa] gi|550347801|gb|EEE83008.2| chloroplast outer membrane translocon subunit family protein [Populus trichocarpa] Length = 599 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -2 Query: 417 GTAKESLFFYKEAHQDFKHALVLEPQNKVASLVEKRLRKLI 295 GTA+ESL FYK+A QDFKHALVLEPQNKVA EKRLRKL+ Sbjct: 558 GTARESLLFYKDAAQDFKHALVLEPQNKVARHAEKRLRKLM 598 >ref|XP_004136877.1| PREDICTED: outer envelope protein 64, mitochondrial-like [Cucumis sativus] Length = 606 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 417 GTAKESLFFYKEAHQDFKHALVLEPQNKVASLVEKRLRKLI 295 GTA+ESL YKEA +DFKHALVLEPQNKVA+L EKRL+KLI Sbjct: 565 GTARESLLLYKEAIKDFKHALVLEPQNKVANLAEKRLQKLI 605 >ref|XP_006341842.1| PREDICTED: outer envelope protein 64, mitochondrial-like [Solanum tuberosum] Length = 598 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -2 Query: 417 GTAKESLFFYKEAHQDFKHALVLEPQNKVASLVEKRLRKLI 295 GTA+ESL FYKEA QD +HALVLEPQNK AS+ EKRLRKLI Sbjct: 557 GTARESLLFYKEALQDIRHALVLEPQNKFASVSEKRLRKLI 597 >ref|XP_004248799.1| PREDICTED: outer envelope protein 64, mitochondrial-like [Solanum lycopersicum] Length = 598 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -2 Query: 417 GTAKESLFFYKEAHQDFKHALVLEPQNKVASLVEKRLRKLI 295 GTA+ESL FYKEA QD +HALVLEPQNK AS+ EKRLRKLI Sbjct: 557 GTARESLLFYKEALQDIRHALVLEPQNKYASVSEKRLRKLI 597 >ref|XP_007200962.1| hypothetical protein PRUPE_ppa003071mg [Prunus persica] gi|462396362|gb|EMJ02161.1| hypothetical protein PRUPE_ppa003071mg [Prunus persica] Length = 607 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -2 Query: 417 GTAKESLFFYKEAHQDFKHALVLEPQNKVASLVEKRLRKLI 295 GTA+ESL YK+A QDFKHALVLEPQNKVA+L EKRLR+L+ Sbjct: 566 GTARESLLCYKDAAQDFKHALVLEPQNKVANLAEKRLRELM 606 >gb|EPS65438.1| hypothetical protein M569_09339, partial [Genlisea aurea] Length = 592 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -2 Query: 417 GTAKESLFFYKEAHQDFKHALVLEPQNKVASLVEKRLRKLI 295 GTAKESL FYKEA QDFKHALVLEP NK A+ EKRLR+L+ Sbjct: 551 GTAKESLLFYKEALQDFKHALVLEPHNKAAAEAEKRLRRLL 591 >ref|XP_003524732.1| PREDICTED: outer envelope protein 64, mitochondrial-like [Glycine max] Length = 603 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -2 Query: 417 GTAKESLFFYKEAHQDFKHALVLEPQNKVASLVEKRLRKLI 295 GTA+ESL Y+EA +DFKHALVLEPQNK ASL EKRLRKL+ Sbjct: 562 GTARESLLCYEEALEDFKHALVLEPQNKDASLAEKRLRKLM 602 >ref|XP_004504805.1| PREDICTED: LOW QUALITY PROTEIN: outer envelope protein 64, mitochondrial-like [Cicer arietinum] Length = 606 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -2 Query: 417 GTAKESLFFYKEAHQDFKHALVLEPQNKVASLVEKRLRKLI 295 GTA+ESL YKEA +DFKHALVLEPQNK AS+ EKR+RKL+ Sbjct: 565 GTARESLLRYKEALEDFKHALVLEPQNKDASVAEKRVRKLL 605 >ref|XP_002525865.1| amidase, putative [Ricinus communis] gi|223534870|gb|EEF36559.1| amidase, putative [Ricinus communis] Length = 607 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -2 Query: 417 GTAKESLFFYKEAHQDFKHALVLEPQNKVASLVEKRLRKLI 295 GTAKESL +YKEA QDFKHALVLEP NK A E+RLRKL+ Sbjct: 566 GTAKESLLYYKEAAQDFKHALVLEPHNKAAREAEERLRKLM 606 >ref|XP_006286476.1| hypothetical protein CARUB_v10000509mg [Capsella rubella] gi|482555182|gb|EOA19374.1| hypothetical protein CARUB_v10000509mg [Capsella rubella] Length = 604 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -2 Query: 417 GTAKESLFFYKEAHQDFKHALVLEPQNKVASLVEKRLRKLI 295 GTA+ESL YKEA DF+HALVLEPQNK A L EKRLRKL+ Sbjct: 563 GTARESLVRYKEAAADFRHALVLEPQNKTAKLAEKRLRKLM 603 >ref|XP_007159113.1| hypothetical protein PHAVU_002G209800g [Phaseolus vulgaris] gi|561032528|gb|ESW31107.1| hypothetical protein PHAVU_002G209800g [Phaseolus vulgaris] Length = 602 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -2 Query: 417 GTAKESLFFYKEAHQDFKHALVLEPQNKVASLVEKRLRKLI 295 G A+ESL Y+EA +DFKHALVLEPQNK ASL EKRLRKL+ Sbjct: 561 GAARESLLCYEEALEDFKHALVLEPQNKDASLAEKRLRKLM 601 >ref|XP_003531546.1| PREDICTED: outer envelope protein 64, mitochondrial-like isoform X1 [Glycine max] Length = 598 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -2 Query: 417 GTAKESLFFYKEAHQDFKHALVLEPQNKVASLVEKRLRK 301 GTA+E L YKEA +DF+HALVLEPQNK ASL EKRLRK Sbjct: 557 GTAREVLLCYKEALKDFQHALVLEPQNKTASLAEKRLRK 595 >ref|XP_006597351.1| PREDICTED: outer envelope protein 64, mitochondrial-like isoform X2 [Glycine max] Length = 506 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -2 Query: 417 GTAKESLFFYKEAHQDFKHALVLEPQNKVASLVEKRLRK 301 GTA+E L YKEA +DF+HALVLEPQNK ASL EKRLRK Sbjct: 465 GTARELLLRYKEALKDFQHALVLEPQNKTASLAEKRLRK 503 >ref|XP_006597350.1| PREDICTED: outer envelope protein 64, mitochondrial-like isoform X1 [Glycine max] Length = 598 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -2 Query: 417 GTAKESLFFYKEAHQDFKHALVLEPQNKVASLVEKRLRK 301 GTA+E L YKEA +DF+HALVLEPQNK ASL EKRLRK Sbjct: 557 GTARELLLRYKEALKDFQHALVLEPQNKTASLAEKRLRK 595 >ref|XP_006399420.1| hypothetical protein EUTSA_v10013019mg [Eutrema salsugineum] gi|557100510|gb|ESQ40873.1| hypothetical protein EUTSA_v10013019mg [Eutrema salsugineum] Length = 602 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -2 Query: 417 GTAKESLFFYKEAHQDFKHALVLEPQNKVASLVEKRLRKLI 295 GTA+ESL YKEA DF+HALVLEPQNK A EKRLRKL+ Sbjct: 561 GTARESLIRYKEAAADFRHALVLEPQNKTAKNAEKRLRKLM 601 >ref|NP_196504.2| translocon at the outer membrane of chloroplasts 64-V [Arabidopsis thaliana] gi|357580466|sp|F4KCL7.1|OE64M_ARATH RecName: Full=Outer envelope protein 64, mitochondrial; AltName: Full=Mitochondrial outer membrane protein 64; Short=mtOM64; AltName: Full=Translocon at the outer membrane of chloroplasts 64-V; Short=AtTOC64-V gi|332004008|gb|AED91391.1| translocon at the outer membrane of chloroplasts 64-V [Arabidopsis thaliana] Length = 603 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -2 Query: 417 GTAKESLFFYKEAHQDFKHALVLEPQNKVASLVEKRLRKLI 295 GTA+ESL YKEA DF+HALVLEPQNK A + EKRLRK I Sbjct: 563 GTARESLVRYKEAAADFRHALVLEPQNKTAKVAEKRLRKHI 603