BLASTX nr result
ID: Mentha27_contig00019867
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00019867 (381 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29726.1| hypothetical protein MIMGU_mgv1a003867mg [Mimulus... 60 2e-07 >gb|EYU29726.1| hypothetical protein MIMGU_mgv1a003867mg [Mimulus guttatus] Length = 559 Score = 60.5 bits (145), Expect = 2e-07 Identities = 34/60 (56%), Positives = 46/60 (76%), Gaps = 1/60 (1%) Frame = -2 Query: 188 MPALAASRVLLLVGDAISSGKYCVFTR-VTPRYSSLRRFSCVSNENIRSLTLKSLGFRNE 12 MPALAA+RVLL V D +SSGK+ F+R V PRY S+R + V+NE+ + LTL +LGF++E Sbjct: 1 MPALAATRVLLFVADTLSSGKFYGFSRVVAPRYGSVRFLTRVTNES-QPLTLATLGFKSE 59