BLASTX nr result
ID: Mentha27_contig00019717
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00019717 (218 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21976.1| hypothetical protein MIMGU_mgv1a008814mg [Mimulus... 69 9e-10 >gb|EYU21976.1| hypothetical protein MIMGU_mgv1a008814mg [Mimulus guttatus] Length = 361 Score = 68.6 bits (166), Expect = 9e-10 Identities = 40/76 (52%), Positives = 52/76 (68%), Gaps = 10/76 (13%) Frame = +3 Query: 15 LGLQRELATVP---------SSSAED-FPETGKEASLSIGVGYGLIYLLKYELNKMVELR 164 LGLQR+ V SSS ED E+GKEAS ++GVG+G+IY+++ ELNKM ELR Sbjct: 65 LGLQRKNEIVKGGSTNHEASSSSIEDVLAESGKEASFNLGVGFGVIYVVRNELNKMAELR 124 Query: 165 RRIESLLQHFQTEIEN 212 +RIE LLQ FQ + +N Sbjct: 125 KRIELLLQDFQNQEKN 140