BLASTX nr result
ID: Mentha27_contig00019499
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00019499 (343 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGX93067.1| 7-deoxyloganetic acid UDP-glucosyltransferase-lik... 56 6e-06 >gb|AGX93067.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Cinchona calisaya] Length = 483 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = +3 Query: 3 KRAEDMAKLANKAVNEGGSSYCDLDALIHYIKSLL 107 +RA+DMAKLA KAVNEGGSSY +LDAL+ YIKS++ Sbjct: 448 QRADDMAKLARKAVNEGGSSYQNLDALVEYIKSMV 482