BLASTX nr result
ID: Mentha27_contig00019304
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00019304 (323 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004485930.1| PREDICTED: uncharacterized protein LOC101513... 59 9e-07 >ref|XP_004485930.1| PREDICTED: uncharacterized protein LOC101513953 [Cicer arietinum] Length = 96 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/61 (45%), Positives = 43/61 (70%) Frame = +2 Query: 140 VMGVIVFCSLASSIEGRRLLMKVENKNIPLSGEESLYRAALPKGKVAASTPSRRGNAAVY 319 V+ +I+F SL S +EGR+L +K NK I S ++S++ ++LPKGK+ S PS+RGN+ Sbjct: 10 VLLLILFASLCSILEGRKLHLKHSNKKIDPSSKDSVFLSSLPKGKIPYSAPSKRGNSVEV 69 Query: 320 D 322 D Sbjct: 70 D 70