BLASTX nr result
ID: Mentha27_contig00019219
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00019219 (274 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006375382.1| hypothetical protein POPTR_0014s10010g [Popu... 89 8e-16 gb|EXB83831.1| 3-ketoacyl-CoA synthase 1 [Morus notabilis] 87 2e-15 ref|XP_002529975.1| acyltransferase, putative [Ricinus communis]... 87 2e-15 gb|EYU32293.1| hypothetical protein MIMGU_mgv1a004078mg [Mimulus... 86 5e-15 ref|XP_002301436.2| fatty acid elongase 3-ketoacyl-CoA synthase ... 85 1e-14 gb|AET83339.1| hypothetical protein, partial [Pinus contorta var... 85 1e-14 gb|AET83309.1| hypothetical protein, partial [Pinus contorta var... 85 1e-14 ref|XP_004306622.1| PREDICTED: 3-ketoacyl-CoA synthase 1-like [F... 84 2e-14 ref|XP_002977865.1| hypothetical protein SELMODRAFT_443640 [Sela... 84 2e-14 ref|XP_002979460.1| hypothetical protein SELMODRAFT_444233 [Sela... 84 2e-14 ref|XP_006387087.1| hypothetical protein POPTR_1902s002001g, par... 84 3e-14 ref|XP_002264721.1| PREDICTED: 3-ketoacyl-CoA synthase 1-like [V... 84 3e-14 ref|XP_003626601.1| 3-ketoacyl-CoA synthase [Medicago truncatula... 83 3e-14 gb|AFG67884.1| hypothetical protein 2_1205_02, partial [Pinus ta... 83 3e-14 ref|XP_002313793.1| hypothetical protein POPTR_0009s11940g [Popu... 83 3e-14 gb|ABK24632.1| unknown [Picea sitchensis] 83 3e-14 ref|XP_007051450.1| 3-ketoacyl-CoA synthase 1 [Theobroma cacao] ... 82 6e-14 ref|NP_199189.1| 3-ketoacyl-CoA synthase 20 [Arabidopsis thalian... 82 6e-14 ref|XP_002865403.1| hypothetical protein ARALYDRAFT_356713 [Arab... 82 6e-14 gb|AAK59535.1| putative beta-ketoacyl-CoA synthase [Arabidopsis ... 82 6e-14 >ref|XP_006375382.1| hypothetical protein POPTR_0014s10010g [Populus trichocarpa] gi|550323868|gb|ERP53179.1| hypothetical protein POPTR_0014s10010g [Populus trichocarpa] Length = 525 Score = 88.6 bits (218), Expect = 8e-16 Identities = 37/50 (74%), Positives = 43/50 (86%) Frame = -2 Query: 273 GDRVWQIAFGSGFKCNSAVWKALRDIPPKHNQANPWFDCIDKYPVQIPVS 124 GDRVWQIAFGSGFKCNSAVWKALR IP ++ NPW D ID+YPV++PV+ Sbjct: 476 GDRVWQIAFGSGFKCNSAVWKALRKIPAGESKGNPWIDSIDRYPVKVPVA 525 >gb|EXB83831.1| 3-ketoacyl-CoA synthase 1 [Morus notabilis] Length = 534 Score = 87.4 bits (215), Expect = 2e-15 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = -2 Query: 273 GDRVWQIAFGSGFKCNSAVWKALRDIPPKHNQANPWFDCIDKYPVQIPVS 124 GDRVWQIAFGSGFKCNSAVWKALR++P NPW DCID+YPV++P + Sbjct: 485 GDRVWQIAFGSGFKCNSAVWKALREVPVGEFLGNPWNDCIDRYPVKVPTA 534 >ref|XP_002529975.1| acyltransferase, putative [Ricinus communis] gi|223530537|gb|EEF32418.1| acyltransferase, putative [Ricinus communis] Length = 527 Score = 87.0 bits (214), Expect = 2e-15 Identities = 37/50 (74%), Positives = 44/50 (88%) Frame = -2 Query: 273 GDRVWQIAFGSGFKCNSAVWKALRDIPPKHNQANPWFDCIDKYPVQIPVS 124 GDRVWQIAFGSGFKCNSAVWKALR IP +++NPW D ID+YPV++PV+ Sbjct: 478 GDRVWQIAFGSGFKCNSAVWKALRAIPCGESRSNPWADSIDRYPVKVPVA 527 >gb|EYU32293.1| hypothetical protein MIMGU_mgv1a004078mg [Mimulus guttatus] Length = 545 Score = 85.9 bits (211), Expect = 5e-15 Identities = 40/56 (71%), Positives = 46/56 (82%), Gaps = 2/56 (3%) Frame = -2 Query: 273 GDRVWQIAFGSGFKCNSAVWKALRDIPPKH-NQANPWFDCIDKYPV-QIPVSTAAA 112 G+RVWQIAFGSGFKCNSAVWKALRDIP K NPWFDCID YPV +P S++++ Sbjct: 490 GNRVWQIAFGSGFKCNSAVWKALRDIPAKDCPSTNPWFDCIDNYPVLLLPTSSSSS 545 >ref|XP_002301436.2| fatty acid elongase 3-ketoacyl-CoA synthase 1 family protein [Populus trichocarpa] gi|550345250|gb|EEE80709.2| fatty acid elongase 3-ketoacyl-CoA synthase 1 family protein [Populus trichocarpa] Length = 527 Score = 84.7 bits (208), Expect = 1e-14 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = -2 Query: 273 GDRVWQIAFGSGFKCNSAVWKALRDIPPKHNQANPWFDCIDKYPVQIP 130 GDRVWQIAFGSGFKCNSAVWKALR+IP ++ NPW D ID YPV++P Sbjct: 478 GDRVWQIAFGSGFKCNSAVWKALREIPAGESKGNPWNDSIDWYPVKVP 525 >gb|AET83339.1| hypothetical protein, partial [Pinus contorta var. bolanderi] Length = 112 Score = 84.7 bits (208), Expect = 1e-14 Identities = 36/49 (73%), Positives = 42/49 (85%) Frame = -2 Query: 273 GDRVWQIAFGSGFKCNSAVWKALRDIPPKHNQANPWFDCIDKYPVQIPV 127 GDR+WQIAFGSGFKCNSAVWKALR + K + NPWFDCID YPV++P+ Sbjct: 64 GDRLWQIAFGSGFKCNSAVWKALRPVQAK-SPKNPWFDCIDNYPVKVPM 111 >gb|AET83309.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534513|gb|AET83310.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534515|gb|AET83311.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534517|gb|AET83312.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534519|gb|AET83313.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534521|gb|AET83314.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534523|gb|AET83315.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534525|gb|AET83316.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534527|gb|AET83317.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534529|gb|AET83318.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534531|gb|AET83319.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534533|gb|AET83320.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534535|gb|AET83321.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534537|gb|AET83322.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534539|gb|AET83323.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534541|gb|AET83324.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534543|gb|AET83325.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534545|gb|AET83326.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534547|gb|AET83327.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534549|gb|AET83328.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534551|gb|AET83329.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534553|gb|AET83330.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534555|gb|AET83331.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534557|gb|AET83332.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534559|gb|AET83333.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534561|gb|AET83334.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534563|gb|AET83335.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534565|gb|AET83336.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534567|gb|AET83337.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534569|gb|AET83338.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534573|gb|AET83340.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534575|gb|AET83341.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534577|gb|AET83342.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534579|gb|AET83343.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534581|gb|AET83344.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534583|gb|AET83345.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534585|gb|AET83346.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534587|gb|AET83347.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534589|gb|AET83348.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534591|gb|AET83349.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534593|gb|AET83350.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534595|gb|AET83351.1| hypothetical protein, partial [Pinus contorta var. bolanderi] gi|357534597|gb|AET83352.1| hypothetical protein, partial [Pinus contorta var. murrayana] gi|357534599|gb|AET83353.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534601|gb|AET83354.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534603|gb|AET83355.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534605|gb|AET83356.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534607|gb|AET83357.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534609|gb|AET83358.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534611|gb|AET83359.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534613|gb|AET83360.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534615|gb|AET83361.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534617|gb|AET83362.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534619|gb|AET83363.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534621|gb|AET83364.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534623|gb|AET83365.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534625|gb|AET83366.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534627|gb|AET83367.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534629|gb|AET83368.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534631|gb|AET83369.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534633|gb|AET83370.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534635|gb|AET83371.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534637|gb|AET83372.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534639|gb|AET83373.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534641|gb|AET83374.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534643|gb|AET83375.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534645|gb|AET83376.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534647|gb|AET83377.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534649|gb|AET83378.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534651|gb|AET83379.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534653|gb|AET83380.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534655|gb|AET83381.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534657|gb|AET83382.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534659|gb|AET83383.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534661|gb|AET83384.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534663|gb|AET83385.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534665|gb|AET83386.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534667|gb|AET83387.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534669|gb|AET83388.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534671|gb|AET83389.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534673|gb|AET83390.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534675|gb|AET83391.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534677|gb|AET83392.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534679|gb|AET83393.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534681|gb|AET83394.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534683|gb|AET83395.1| hypothetical protein, partial [Pinus contorta subsp. contorta] gi|357534685|gb|AET83396.1| hypothetical protein, partial [Pinus contorta var. murrayana] gi|361068029|gb|AEW08326.1| hypothetical protein 2_6428_01, partial [Pinus radiata] gi|383166407|gb|AFG66151.1| hypothetical protein 2_6428_01, partial [Pinus taeda] gi|383166409|gb|AFG66152.1| hypothetical protein 2_6428_01, partial [Pinus taeda] gi|383166411|gb|AFG66153.1| hypothetical protein 2_6428_01, partial [Pinus taeda] gi|383166413|gb|AFG66154.1| hypothetical protein 2_6428_01, partial [Pinus taeda] gi|383166415|gb|AFG66155.1| hypothetical protein 2_6428_01, partial [Pinus taeda] gi|383166417|gb|AFG66156.1| hypothetical protein 2_6428_01, partial [Pinus taeda] gi|383166419|gb|AFG66157.1| hypothetical protein 2_6428_01, partial [Pinus taeda] gi|383166421|gb|AFG66158.1| hypothetical protein 2_6428_01, partial [Pinus taeda] gi|383166423|gb|AFG66159.1| hypothetical protein 2_6428_01, partial [Pinus taeda] gi|383166425|gb|AFG66160.1| hypothetical protein 2_6428_01, partial [Pinus taeda] gi|383166427|gb|AFG66161.1| hypothetical protein 2_6428_01, partial [Pinus taeda] gi|383166429|gb|AFG66162.1| hypothetical protein 2_6428_01, partial [Pinus taeda] gi|383166431|gb|AFG66163.1| hypothetical protein 2_6428_01, partial [Pinus taeda] gi|383166433|gb|AFG66164.1| hypothetical protein 2_6428_01, partial [Pinus taeda] gi|383166435|gb|AFG66165.1| hypothetical protein 2_6428_01, partial [Pinus taeda] gi|383166437|gb|AFG66166.1| hypothetical protein 2_6428_01, partial [Pinus taeda] Length = 125 Score = 84.7 bits (208), Expect = 1e-14 Identities = 36/49 (73%), Positives = 42/49 (85%) Frame = -2 Query: 273 GDRVWQIAFGSGFKCNSAVWKALRDIPPKHNQANPWFDCIDKYPVQIPV 127 GDR+WQIAFGSGFKCNSAVWKALR + K + NPWFDCID YPV++P+ Sbjct: 77 GDRLWQIAFGSGFKCNSAVWKALRPVQAK-SPKNPWFDCIDNYPVKVPM 124 >ref|XP_004306622.1| PREDICTED: 3-ketoacyl-CoA synthase 1-like [Fragaria vesca subsp. vesca] Length = 536 Score = 84.3 bits (207), Expect = 2e-14 Identities = 33/50 (66%), Positives = 41/50 (82%) Frame = -2 Query: 273 GDRVWQIAFGSGFKCNSAVWKALRDIPPKHNQANPWFDCIDKYPVQIPVS 124 GDR+WQIAFGSGFKCNSAVW+A+R + NPW DCID+YPV++PV+ Sbjct: 486 GDRIWQIAFGSGFKCNSAVWRAIRPVVEGDQLGNPWMDCIDRYPVKVPVA 535 >ref|XP_002977865.1| hypothetical protein SELMODRAFT_443640 [Selaginella moellendorffii] gi|300154568|gb|EFJ21203.1| hypothetical protein SELMODRAFT_443640 [Selaginella moellendorffii] Length = 510 Score = 84.0 bits (206), Expect = 2e-14 Identities = 39/49 (79%), Positives = 41/49 (83%), Gaps = 1/49 (2%) Frame = -2 Query: 273 GDRVWQIAFGSGFKCNSAVWKALRDI-PPKHNQANPWFDCIDKYPVQIP 130 GDRVWQIAFGSGFKCNSAVW+ALR I PP H PW DCIDKYPV+IP Sbjct: 460 GDRVWQIAFGSGFKCNSAVWRALRSIKPPSH---GPWEDCIDKYPVRIP 505 >ref|XP_002979460.1| hypothetical protein SELMODRAFT_444233 [Selaginella moellendorffii] gi|300152708|gb|EFJ19349.1| hypothetical protein SELMODRAFT_444233 [Selaginella moellendorffii] Length = 510 Score = 84.0 bits (206), Expect = 2e-14 Identities = 39/49 (79%), Positives = 41/49 (83%), Gaps = 1/49 (2%) Frame = -2 Query: 273 GDRVWQIAFGSGFKCNSAVWKALRDI-PPKHNQANPWFDCIDKYPVQIP 130 GDRVWQIAFGSGFKCNSAVW+ALR I PP H PW DCIDKYPV+IP Sbjct: 460 GDRVWQIAFGSGFKCNSAVWRALRSIKPPSH---GPWEDCIDKYPVRIP 505 >ref|XP_006387087.1| hypothetical protein POPTR_1902s002001g, partial [Populus trichocarpa] gi|550304797|gb|ERP46001.1| hypothetical protein POPTR_1902s002001g, partial [Populus trichocarpa] Length = 125 Score = 83.6 bits (205), Expect = 3e-14 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -2 Query: 273 GDRVWQIAFGSGFKCNSAVWKALRDIPPKHNQANPWFDCIDKYPVQIPV 127 GDR+WQIAFGSGFKCNSA+W+ALR I P N NPW DCID+YPVQI + Sbjct: 79 GDRIWQIAFGSGFKCNSAIWEALRHIKPSSN--NPWQDCIDRYPVQIVI 125 >ref|XP_002264721.1| PREDICTED: 3-ketoacyl-CoA synthase 1-like [Vitis vinifera] Length = 530 Score = 83.6 bits (205), Expect = 3e-14 Identities = 34/49 (69%), Positives = 42/49 (85%) Frame = -2 Query: 273 GDRVWQIAFGSGFKCNSAVWKALRDIPPKHNQANPWFDCIDKYPVQIPV 127 GDRVWQIAFGSGFKCNSAVW++LR+IP + NPW D +D+YPV++PV Sbjct: 477 GDRVWQIAFGSGFKCNSAVWRSLREIPVGESGDNPWADSVDRYPVKVPV 525 >ref|XP_003626601.1| 3-ketoacyl-CoA synthase [Medicago truncatula] gi|87240844|gb|ABD32702.1| Chalcone and stilbene synthases, N-terminal; Chalcone and stilbene synthases, C-terminal; Very-long-chain 3-ketoacyl-CoA synthase [Medicago truncatula] gi|355501616|gb|AES82819.1| 3-ketoacyl-CoA synthase [Medicago truncatula] Length = 534 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/54 (68%), Positives = 44/54 (81%), Gaps = 1/54 (1%) Frame = -2 Query: 273 GDRVWQIAFGSGFKCNSAVWKALRDIPPKHN-QANPWFDCIDKYPVQIPVSTAA 115 GDRVWQIAFGSGFKCNSAVWKA+RD+P + + NPW D + KYPV +PVS A+ Sbjct: 481 GDRVWQIAFGSGFKCNSAVWKAVRDLPVVGDWRGNPWDDSVHKYPVSVPVSVAS 534 >gb|AFG67884.1| hypothetical protein 2_1205_02, partial [Pinus taeda] gi|383169478|gb|AFG67885.1| hypothetical protein 2_1205_02, partial [Pinus taeda] gi|383169480|gb|AFG67886.1| hypothetical protein 2_1205_02, partial [Pinus taeda] gi|383169482|gb|AFG67887.1| hypothetical protein 2_1205_02, partial [Pinus taeda] gi|383169484|gb|AFG67888.1| hypothetical protein 2_1205_02, partial [Pinus taeda] gi|383169486|gb|AFG67889.1| hypothetical protein 2_1205_02, partial [Pinus taeda] gi|383169488|gb|AFG67890.1| hypothetical protein 2_1205_02, partial [Pinus taeda] gi|383169490|gb|AFG67891.1| hypothetical protein 2_1205_02, partial [Pinus taeda] gi|383169492|gb|AFG67892.1| hypothetical protein 2_1205_02, partial [Pinus taeda] gi|383169494|gb|AFG67893.1| hypothetical protein 2_1205_02, partial [Pinus taeda] gi|383169496|gb|AFG67894.1| hypothetical protein 2_1205_02, partial [Pinus taeda] gi|383169498|gb|AFG67895.1| hypothetical protein 2_1205_02, partial [Pinus taeda] gi|383169500|gb|AFG67896.1| hypothetical protein 2_1205_02, partial [Pinus taeda] gi|383169502|gb|AFG67897.1| hypothetical protein 2_1205_02, partial [Pinus taeda] gi|383169504|gb|AFG67898.1| hypothetical protein 2_1205_02, partial [Pinus taeda] gi|383169506|gb|AFG67899.1| hypothetical protein 2_1205_02, partial [Pinus taeda] Length = 54 Score = 83.2 bits (204), Expect = 3e-14 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = -2 Query: 273 GDRVWQIAFGSGFKCNSAVWKALRDIPPKHNQANPWFDCIDKYPVQIP 130 GDRVWQIAFGSGFKCNSAVWK LR + K + NPW DC+D+YPV+IP Sbjct: 4 GDRVWQIAFGSGFKCNSAVWKTLRTV--KRSTKNPWLDCVDRYPVEIP 49 >ref|XP_002313793.1| hypothetical protein POPTR_0009s11940g [Populus trichocarpa] gi|222850201|gb|EEE87748.1| hypothetical protein POPTR_0009s11940g [Populus trichocarpa] Length = 510 Score = 83.2 bits (204), Expect = 3e-14 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = -2 Query: 273 GDRVWQIAFGSGFKCNSAVWKALRDIPPKHNQANPWFDCIDKYPVQI 133 GDR+WQIAFGSGFKCNSA+W+ALR I P N NPW DCID+YPVQI Sbjct: 464 GDRIWQIAFGSGFKCNSAIWEALRHIKPSSN--NPWQDCIDRYPVQI 508 >gb|ABK24632.1| unknown [Picea sitchensis] Length = 530 Score = 83.2 bits (204), Expect = 3e-14 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = -2 Query: 273 GDRVWQIAFGSGFKCNSAVWKALRDIPPKHNQANPWFDCIDKYPVQIP 130 GDRVWQIAFGSGFKCNSAVWK LR + K + NPW DC+D+YPV+IP Sbjct: 480 GDRVWQIAFGSGFKCNSAVWKTLRTV--KRSTKNPWLDCVDRYPVEIP 525 >ref|XP_007051450.1| 3-ketoacyl-CoA synthase 1 [Theobroma cacao] gi|508703711|gb|EOX95607.1| 3-ketoacyl-CoA synthase 1 [Theobroma cacao] Length = 530 Score = 82.4 bits (202), Expect = 6e-14 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = -2 Query: 273 GDRVWQIAFGSGFKCNSAVWKALRDIPPKHNQANPWFDCIDKYPVQIPV 127 GDRVWQIAFGSGFKCNSAVW+ALR P ++ NPW D I+KYPV++P+ Sbjct: 481 GDRVWQIAFGSGFKCNSAVWRALRSTPESESRGNPWKDEIEKYPVKVPL 529 >ref|NP_199189.1| 3-ketoacyl-CoA synthase 20 [Arabidopsis thaliana] gi|75262422|sp|Q9FG87.1|KCS19_ARATH RecName: Full=3-ketoacyl-CoA synthase 19; Short=KCS-19; AltName: Full=Very long-chain fatty acid condensing enzyme 19; Short=VLCFA condensing enzyme 19 gi|15983491|gb|AAL11613.1|AF424620_1 AT5g43760/MQD19_11 [Arabidopsis thaliana] gi|10177945|dbj|BAB11304.1| beta-ketoacyl-CoA synthase [Arabidopsis thaliana] gi|23297625|gb|AAN12994.1| beta-ketoacyl-CoA synthase [Arabidopsis thaliana] gi|332007624|gb|AED95007.1| 3-ketoacyl-CoA synthase 20 [Arabidopsis thaliana] Length = 529 Score = 82.4 bits (202), Expect = 6e-14 Identities = 35/48 (72%), Positives = 38/48 (79%) Frame = -2 Query: 273 GDRVWQIAFGSGFKCNSAVWKALRDIPPKHNQANPWFDCIDKYPVQIP 130 GDR WQIAFGSGFKCNSAVWKALR I P + NPW D ID +PVQ+P Sbjct: 474 GDRTWQIAFGSGFKCNSAVWKALRTIDPMDEKTNPWIDEIDDFPVQVP 521 >ref|XP_002865403.1| hypothetical protein ARALYDRAFT_356713 [Arabidopsis lyrata subsp. lyrata] gi|297311238|gb|EFH41662.1| hypothetical protein ARALYDRAFT_356713 [Arabidopsis lyrata subsp. lyrata] Length = 270 Score = 82.4 bits (202), Expect = 6e-14 Identities = 35/48 (72%), Positives = 38/48 (79%) Frame = -2 Query: 273 GDRVWQIAFGSGFKCNSAVWKALRDIPPKHNQANPWFDCIDKYPVQIP 130 GDR WQIAFGSGFKCNSAVWKALR I P + NPW D ID +PVQ+P Sbjct: 215 GDRTWQIAFGSGFKCNSAVWKALRTIDPMDEKTNPWIDEIDDFPVQVP 262 >gb|AAK59535.1| putative beta-ketoacyl-CoA synthase [Arabidopsis thaliana] Length = 529 Score = 82.4 bits (202), Expect = 6e-14 Identities = 35/48 (72%), Positives = 38/48 (79%) Frame = -2 Query: 273 GDRVWQIAFGSGFKCNSAVWKALRDIPPKHNQANPWFDCIDKYPVQIP 130 GDR WQIAFGSGFKCNSAVWKALR I P + NPW D ID +PVQ+P Sbjct: 474 GDRTWQIAFGSGFKCNSAVWKALRTIDPMDEKTNPWIDEIDDFPVQVP 521