BLASTX nr result
ID: Mentha27_contig00019061
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00019061 (242 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74288.1| peroxisomal ascorbate peroxidase, partial [Genlis... 59 9e-07 gb|EYU37948.1| hypothetical protein MIMGU_mgv1a011241mg [Mimulus... 57 2e-06 gb|EYU37947.1| hypothetical protein MIMGU_mgv1a011241mg [Mimulus... 57 2e-06 gb|ABS70719.1| peroxisomal ascorbate peroxidase [Avicennia marin... 56 5e-06 emb|CAH59427.1| ascorbate peroxidase [Plantago major] 56 6e-06 >gb|EPS74288.1| peroxisomal ascorbate peroxidase, partial [Genlisea aurea] Length = 282 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 145 MAKVIVDSEYLKDVERARRELRSLIAGKNCAP 240 MAK+IVDSEYLKDVE+ARRELR+LIA KNCAP Sbjct: 1 MAKLIVDSEYLKDVEKARRELRALIAYKNCAP 32 >gb|EYU37948.1| hypothetical protein MIMGU_mgv1a011241mg [Mimulus guttatus] Length = 261 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +1 Query: 145 MAKVIVDSEYLKDVERARRELRSLIAGKNCAP 240 MAK+IVDSEYLKDV++ARRELR+LI+ KNCAP Sbjct: 1 MAKLIVDSEYLKDVDKARRELRALISNKNCAP 32 >gb|EYU37947.1| hypothetical protein MIMGU_mgv1a011241mg [Mimulus guttatus] Length = 288 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +1 Query: 145 MAKVIVDSEYLKDVERARRELRSLIAGKNCAP 240 MAK+IVDSEYLKDV++ARRELR+LI+ KNCAP Sbjct: 1 MAKLIVDSEYLKDVDKARRELRALISNKNCAP 32 >gb|ABS70719.1| peroxisomal ascorbate peroxidase [Avicennia marina] gi|154467192|gb|ABS82577.1| ascorbate peroxidase [Avicennia marina] Length = 286 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/32 (75%), Positives = 31/32 (96%) Frame = +1 Query: 145 MAKVIVDSEYLKDVERARRELRSLIAGKNCAP 240 MAKV+VDS+YLK++E+ARRELR+LI+ KNCAP Sbjct: 1 MAKVVVDSDYLKEIEKARRELRALISNKNCAP 32 >emb|CAH59427.1| ascorbate peroxidase [Plantago major] Length = 289 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +1 Query: 145 MAKVIVDSEYLKDVERARRELRSLIAGKNCAP 240 MAK IVDS+YL+DVE+ARRELR+LI+ KNCAP Sbjct: 1 MAKTIVDSDYLRDVEKARRELRALISNKNCAP 32