BLASTX nr result
ID: Mentha27_contig00018768
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00018768 (648 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22914.1| hypothetical protein MIMGU_mgv1a016971mg [Mimulus... 79 2e-12 ref|XP_006386585.1| hypothetical protein POPTR_0002s15380g [Popu... 79 2e-12 ref|XP_006445187.1| hypothetical protein CICLE_v10023026mg [Citr... 78 2e-12 ref|XP_004172505.1| PREDICTED: ubiquitin-related modifier 1 homo... 78 2e-12 ref|XP_004153667.1| PREDICTED: ubiquitin-related modifier 1 homo... 78 2e-12 ref|XP_004144991.1| PREDICTED: ubiquitin-related modifier 1 homo... 78 2e-12 ref|XP_002511777.1| Protein C9orf74, putative [Ricinus communis]... 78 2e-12 gb|EPS72076.1| hypothetical protein M569_02690, partial [Genlise... 78 3e-12 ref|XP_004510884.1| PREDICTED: ubiquitin-related modifier 1 homo... 78 3e-12 ref|XP_002278537.1| PREDICTED: ubiquitin-related modifier 1 homo... 78 3e-12 emb|CAN82245.1| hypothetical protein VITISV_018251 [Vitis vinifera] 78 3e-12 gb|ABK28333.1| unknown [Arabidopsis thaliana] 78 3e-12 ref|NP_001078064.1| ubiquitin-related modifier 1-1 [Arabidopsis ... 78 3e-12 ref|XP_007134950.1| hypothetical protein PHAVU_010G089300g [Phas... 77 3e-12 ref|XP_002320772.2| hypothetical protein POPTR_0014s07420g [Popu... 77 3e-12 gb|AFK34500.1| unknown [Medicago truncatula] 77 3e-12 ref|XP_007051961.1| Ubiquitin related modifier 1 [Theobroma caca... 77 5e-12 ref|XP_007223737.1| hypothetical protein PRUPE_ppa013867mg [Prun... 77 6e-12 ref|XP_002878362.1| predicted protein [Arabidopsis lyrata subsp.... 77 6e-12 ref|NP_001118872.1| ubiquitin-related modifier 1 [Arabidopsis th... 77 6e-12 >gb|EYU22914.1| hypothetical protein MIMGU_mgv1a016971mg [Mimulus guttatus] Length = 99 Score = 78.6 bits (192), Expect = 2e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +2 Query: 290 RPGVLVLVNDCDWELSGQLETVLEEKDVVVFISTLHGG 403 RPGVLVLVNDCDWELSGQLET+LE+KDVVVFISTLHGG Sbjct: 62 RPGVLVLVNDCDWELSGQLETMLEDKDVVVFISTLHGG 99 >ref|XP_006386585.1| hypothetical protein POPTR_0002s15380g [Populus trichocarpa] gi|550345078|gb|ERP64382.1| hypothetical protein POPTR_0002s15380g [Populus trichocarpa] Length = 70 Score = 78.6 bits (192), Expect = 2e-12 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +2 Query: 284 CRRPGVLVLVNDCDWELSGQLETVLEEKDVVVFISTLHGG 403 CRRPGVLVLVNDCDWE SGQL+T LEEKD+VVFISTLHGG Sbjct: 31 CRRPGVLVLVNDCDWEHSGQLDTNLEEKDLVVFISTLHGG 70 >ref|XP_006445187.1| hypothetical protein CICLE_v10023026mg [Citrus clementina] gi|568875800|ref|XP_006490978.1| PREDICTED: ubiquitin-related modifier 1 homolog 2-like [Citrus sinensis] gi|557547449|gb|ESR58427.1| hypothetical protein CICLE_v10023026mg [Citrus clementina] Length = 99 Score = 78.2 bits (191), Expect = 2e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +2 Query: 290 RPGVLVLVNDCDWELSGQLETVLEEKDVVVFISTLHGG 403 RPGVLVLVNDCDWELSGQL+T LEEKDVVVFISTLHGG Sbjct: 62 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 99 >ref|XP_004172505.1| PREDICTED: ubiquitin-related modifier 1 homolog 2-like [Cucumis sativus] Length = 101 Score = 78.2 bits (191), Expect = 2e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +2 Query: 290 RPGVLVLVNDCDWELSGQLETVLEEKDVVVFISTLHGG 403 RPGVLVLVNDCDWELSGQL+T LEEKDVVVFISTLHGG Sbjct: 64 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 101 >ref|XP_004153667.1| PREDICTED: ubiquitin-related modifier 1 homolog 2-like [Cucumis sativus] Length = 101 Score = 78.2 bits (191), Expect = 2e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +2 Query: 290 RPGVLVLVNDCDWELSGQLETVLEEKDVVVFISTLHGG 403 RPGVLVLVNDCDWELSGQL+T LEEKDVVVFISTLHGG Sbjct: 64 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 101 >ref|XP_004144991.1| PREDICTED: ubiquitin-related modifier 1 homolog 2-like [Cucumis sativus] Length = 99 Score = 78.2 bits (191), Expect = 2e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +2 Query: 290 RPGVLVLVNDCDWELSGQLETVLEEKDVVVFISTLHGG 403 RPGVLVLVNDCDWELSGQL+T LEEKDVVVFISTLHGG Sbjct: 62 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 99 >ref|XP_002511777.1| Protein C9orf74, putative [Ricinus communis] gi|223548957|gb|EEF50446.1| Protein C9orf74, putative [Ricinus communis] Length = 99 Score = 78.2 bits (191), Expect = 2e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +2 Query: 290 RPGVLVLVNDCDWELSGQLETVLEEKDVVVFISTLHGG 403 RPGVLVLVNDCDWELSGQL+T LEEKDVVVFISTLHGG Sbjct: 62 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 99 >gb|EPS72076.1| hypothetical protein M569_02690, partial [Genlisea aurea] Length = 100 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +2 Query: 290 RPGVLVLVNDCDWELSGQLETVLEEKDVVVFISTLHGG 403 RPGVLVLVNDCDWEL GQLETVLEE+DVVVFISTLHGG Sbjct: 63 RPGVLVLVNDCDWELCGQLETVLEERDVVVFISTLHGG 100 >ref|XP_004510884.1| PREDICTED: ubiquitin-related modifier 1 homolog 1-like [Cicer arietinum] Length = 99 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +2 Query: 290 RPGVLVLVNDCDWELSGQLETVLEEKDVVVFISTLHGG 403 RPGVLVLVNDCDWELSGQL T+LEEKDVVVFISTLHGG Sbjct: 62 RPGVLVLVNDCDWELSGQLSTLLEEKDVVVFISTLHGG 99 >ref|XP_002278537.1| PREDICTED: ubiquitin-related modifier 1 homolog 2 isoform 1 [Vitis vinifera] gi|296089135|emb|CBI38838.3| unnamed protein product [Vitis vinifera] Length = 99 Score = 77.8 bits (190), Expect = 3e-12 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +2 Query: 290 RPGVLVLVNDCDWELSGQLETVLEEKDVVVFISTLHGG 403 RPGVLVLVNDCDWELSGQL+T LEEKDV+VFISTLHGG Sbjct: 62 RPGVLVLVNDCDWELSGQLDTTLEEKDVIVFISTLHGG 99 >emb|CAN82245.1| hypothetical protein VITISV_018251 [Vitis vinifera] Length = 105 Score = 77.8 bits (190), Expect = 3e-12 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +2 Query: 290 RPGVLVLVNDCDWELSGQLETVLEEKDVVVFISTLHGG 403 RPGVLVLVNDCDWELSGQL+T LEEKDV+VFISTLHGG Sbjct: 68 RPGVLVLVNDCDWELSGQLDTTLEEKDVIVFISTLHGG 105 >gb|ABK28333.1| unknown [Arabidopsis thaliana] Length = 102 Score = 77.8 bits (190), Expect = 3e-12 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = +2 Query: 290 RPGVLVLVNDCDWELSGQLETVLEEKDVVVFISTLHGG 403 RPGVLVLVNDCDWELSGQL+TV+E+KDVVVFISTLHGG Sbjct: 64 RPGVLVLVNDCDWELSGQLDTVIEDKDVVVFISTLHGG 101 >ref|NP_001078064.1| ubiquitin-related modifier 1-1 [Arabidopsis thaliana] gi|229557933|sp|A0MDQ1.2|URM11_ARATH RecName: Full=Ubiquitin-related modifier 1 homolog 1 gi|62318675|dbj|BAD95172.1| hypothetical protein [Arabidopsis thaliana] gi|98961773|gb|ABF59216.1| unknown protein [Arabidopsis thaliana] gi|330255494|gb|AEC10588.1| ubiquitin-related modifier 1-1 [Arabidopsis thaliana] Length = 101 Score = 77.8 bits (190), Expect = 3e-12 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = +2 Query: 290 RPGVLVLVNDCDWELSGQLETVLEEKDVVVFISTLHGG 403 RPGVLVLVNDCDWELSGQL+TV+E+KDVVVFISTLHGG Sbjct: 64 RPGVLVLVNDCDWELSGQLDTVIEDKDVVVFISTLHGG 101 >ref|XP_007134950.1| hypothetical protein PHAVU_010G089300g [Phaseolus vulgaris] gi|561007995|gb|ESW06944.1| hypothetical protein PHAVU_010G089300g [Phaseolus vulgaris] Length = 99 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +2 Query: 290 RPGVLVLVNDCDWELSGQLETVLEEKDVVVFISTLHGG 403 RPGVLVLVNDCDWELSGQL+T LEEKDVVVFISTLHGG Sbjct: 62 RPGVLVLVNDCDWELSGQLDTSLEEKDVVVFISTLHGG 99 >ref|XP_002320772.2| hypothetical protein POPTR_0014s07420g [Populus trichocarpa] gi|550323709|gb|EEE99087.2| hypothetical protein POPTR_0014s07420g [Populus trichocarpa] Length = 99 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +2 Query: 290 RPGVLVLVNDCDWELSGQLETVLEEKDVVVFISTLHGG 403 RPGVLVLVNDCDWELSGQL+T LEEKDVVVFISTLHGG Sbjct: 62 RPGVLVLVNDCDWELSGQLDTPLEEKDVVVFISTLHGG 99 >gb|AFK34500.1| unknown [Medicago truncatula] Length = 101 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/38 (94%), Positives = 36/38 (94%) Frame = +2 Query: 290 RPGVLVLVNDCDWELSGQLETVLEEKDVVVFISTLHGG 403 RPGVLVLVNDCDWELSGQL T LEEKDVVVFISTLHGG Sbjct: 64 RPGVLVLVNDCDWELSGQLSTTLEEKDVVVFISTLHGG 101 >ref|XP_007051961.1| Ubiquitin related modifier 1 [Theobroma cacao] gi|508704222|gb|EOX96118.1| Ubiquitin related modifier 1 [Theobroma cacao] Length = 99 Score = 77.0 bits (188), Expect = 5e-12 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +2 Query: 290 RPGVLVLVNDCDWELSGQLETVLEEKDVVVFISTLHGG 403 RPGVLVLVNDCDWEL+GQL+T LEEKDVVVFISTLHGG Sbjct: 62 RPGVLVLVNDCDWELTGQLDTTLEEKDVVVFISTLHGG 99 >ref|XP_007223737.1| hypothetical protein PRUPE_ppa013867mg [Prunus persica] gi|462420673|gb|EMJ24936.1| hypothetical protein PRUPE_ppa013867mg [Prunus persica] Length = 99 Score = 76.6 bits (187), Expect = 6e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +2 Query: 290 RPGVLVLVNDCDWELSGQLETVLEEKDVVVFISTLHGG 403 RPGVL LVNDCDWELSGQL+T LEEKDVVVFISTLHGG Sbjct: 62 RPGVLALVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 99 >ref|XP_002878362.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297324200|gb|EFH54621.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 94 Score = 76.6 bits (187), Expect = 6e-12 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +2 Query: 290 RPGVLVLVNDCDWELSGQLETVLEEKDVVVFISTLHGG 403 RPGVLVLVNDCDWELSGQL+T LE+KDV+VFISTLHGG Sbjct: 57 RPGVLVLVNDCDWELSGQLDTTLEDKDVIVFISTLHGG 94 >ref|NP_001118872.1| ubiquitin-related modifier 1 [Arabidopsis thaliana] gi|238692413|sp|B3H7G2.1|URM12_ARATH RecName: Full=Ubiquitin-related modifier 1 homolog 2 gi|332646635|gb|AEE80156.1| ubiquitin-related modifier 1 [Arabidopsis thaliana] Length = 99 Score = 76.6 bits (187), Expect = 6e-12 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +2 Query: 290 RPGVLVLVNDCDWELSGQLETVLEEKDVVVFISTLHGG 403 RPGVLVLVNDCDWELSGQL+T LE+KDV+VFISTLHGG Sbjct: 62 RPGVLVLVNDCDWELSGQLDTTLEDKDVIVFISTLHGG 99