BLASTX nr result
ID: Mentha27_contig00018233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00018233 (266 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38575.1| hypothetical protein MIMGU_mgv1a013908mg [Mimulus... 63 5e-08 ref|XP_007027470.1| Ankyrin repeat family protein isoform 1 [The... 61 2e-07 ref|XP_002267396.1| PREDICTED: BRCA1-associated RING domain prot... 56 6e-06 emb|CAN64838.1| hypothetical protein VITISV_030376 [Vitis vinifera] 56 6e-06 >gb|EYU38575.1| hypothetical protein MIMGU_mgv1a013908mg [Mimulus guttatus] Length = 207 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/51 (60%), Positives = 40/51 (78%) Frame = +1 Query: 4 GEYGDVIRLLVAHGASPTKKNFKGETPLEIADSETEAWRVLKEAVAKD*SN 156 GEYG+V+RLL+AHGAS TK N G+TP E+AD TEA R+L+EA++ SN Sbjct: 157 GEYGNVVRLLLAHGASLTKTNIYGKTPTELADPGTEARRILEEALSAVSSN 207 >ref|XP_007027470.1| Ankyrin repeat family protein isoform 1 [Theobroma cacao] gi|590631101|ref|XP_007027471.1| Ankyrin repeat family protein isoform 1 [Theobroma cacao] gi|508716075|gb|EOY07972.1| Ankyrin repeat family protein isoform 1 [Theobroma cacao] gi|508716076|gb|EOY07973.1| Ankyrin repeat family protein isoform 1 [Theobroma cacao] Length = 206 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/48 (60%), Positives = 35/48 (72%) Frame = +1 Query: 4 GEYGDVIRLLVAHGASPTKKNFKGETPLEIADSETEAWRVLKEAVAKD 147 GE+ DVIRLL+A+GASPTK N G+ P E+AD ETEAWRV A + Sbjct: 156 GEHVDVIRLLLANGASPTKANIYGKIPRELADPETEAWRVFDAAAGAE 203 >ref|XP_002267396.1| PREDICTED: BRCA1-associated RING domain protein 1 [Vitis vinifera] gi|297739983|emb|CBI30165.3| unnamed protein product [Vitis vinifera] Length = 201 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/47 (57%), Positives = 35/47 (74%) Frame = +1 Query: 4 GEYGDVIRLLVAHGASPTKKNFKGETPLEIADSETEAWRVLKEAVAK 144 GE+ VIRLL+AHGASPTK N G+ P E+AD +TEA R+L+ A + Sbjct: 152 GEHVGVIRLLLAHGASPTKGNIYGKIPSELADMDTEAKRILEAAAVE 198 >emb|CAN64838.1| hypothetical protein VITISV_030376 [Vitis vinifera] Length = 173 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/47 (57%), Positives = 35/47 (74%) Frame = +1 Query: 4 GEYGDVIRLLVAHGASPTKKNFKGETPLEIADSETEAWRVLKEAVAK 144 GE+ VIRLL+AHGASPTK N G+ P E+AD +TEA R+L+ A + Sbjct: 124 GEHVGVIRLLLAHGASPTKGNIYGKIPSELADMDTEAKRILEAAAVE 170