BLASTX nr result
ID: Mentha27_contig00018088
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00018088 (350 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32614.1| hypothetical protein MIMGU_mgv1a023497mg, partial... 55 8e-06 >gb|EYU32614.1| hypothetical protein MIMGU_mgv1a023497mg, partial [Mimulus guttatus] Length = 235 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/38 (73%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = -1 Query: 350 FSSVLHSNSHRKVVEMRKQKY-VPAEGEAIEVNVACGY 240 FSS LHSNSHRKVVEMR+QK V G+ IEVNV+CGY Sbjct: 196 FSSNLHSNSHRKVVEMRRQKQAVVVPGDGIEVNVSCGY 233