BLASTX nr result
ID: Mentha27_contig00017452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00017452 (553 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37921.1| hypothetical protein MIMGU_mgv1a007029mg [Mimulus... 70 5e-10 >gb|EYU37921.1| hypothetical protein MIMGU_mgv1a007029mg [Mimulus guttatus] Length = 422 Score = 69.7 bits (169), Expect = 5e-10 Identities = 36/64 (56%), Positives = 46/64 (71%), Gaps = 7/64 (10%) Frame = -1 Query: 553 KIKEVVSDG----PDPARKNFWSGRER---RQEEKSERAWRKPDSAGSRPQSAGESVTGQ 395 K+KEVVS G P PA+++FWSG R + E K+E+AWRKP+S GSRPQSAGES G Sbjct: 343 KLKEVVSIGTVDVPVPAKRSFWSGNGRDRVQPEHKTEKAWRKPESVGSRPQSAGESENGT 402 Query: 394 SEKS 383 +E + Sbjct: 403 AENT 406