BLASTX nr result
ID: Mentha27_contig00017183
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00017183 (410 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006364266.1| PREDICTED: guanine nucleotide-binding protei... 68 2e-09 ref|NP_001234382.1| nuclear GTPase-like [Solanum lycopersicum] g... 67 3e-09 gb|EYU17983.1| hypothetical protein MIMGU_mgv1a003533mg [Mimulus... 56 5e-06 >ref|XP_006364266.1| PREDICTED: guanine nucleotide-binding protein-like 3 homolog [Solanum tuberosum] Length = 608 Score = 67.8 bits (164), Expect = 2e-09 Identities = 34/56 (60%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = +1 Query: 37 ENQSSAMEHDGNDDYDFKIDYVK-DSAMETGDDVEAADETNTNRFELPSGVELDNE 201 + S+A + DG DYDFK+DY+K DSAM+ ++V A DE+ NRFELPSGVELDNE Sbjct: 555 DKPSTASDMDG--DYDFKVDYIKKDSAMDDANEVVATDESKNNRFELPSGVELDNE 608 >ref|NP_001234382.1| nuclear GTPase-like [Solanum lycopersicum] gi|83630757|gb|ABC26876.1| putative nuclear GTPase [Solanum lycopersicum] Length = 609 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/56 (58%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = +1 Query: 37 ENQSSAMEHDGNDDYDFKIDYVK-DSAMETGDDVEAADETNTNRFELPSGVELDNE 201 + S+A++ DG DYDFK+DY+K DSAM+ D+V A DE+ NRFELPSG +LDNE Sbjct: 556 DKPSTAIDMDG--DYDFKVDYIKKDSAMDDADEVVATDESKNNRFELPSGFKLDNE 609 >gb|EYU17983.1| hypothetical protein MIMGU_mgv1a003533mg [Mimulus guttatus] Length = 579 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/55 (52%), Positives = 37/55 (67%) Frame = +1 Query: 37 ENQSSAMEHDGNDDYDFKIDYVKDSAMETGDDVEAADETNTNRFELPSGVELDNE 201 E Q+ A E DGNDDYDFK+DYVK S+ D+V +E N+ ELPS V++D E Sbjct: 528 EVQTPAKEGDGNDDYDFKVDYVKKSSAMDTDEVGGENE---NKVELPSVVDMDKE 579