BLASTX nr result
ID: Mentha27_contig00017069
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00017069 (344 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004166624.1| PREDICTED: thioredoxin Y1, chloroplastic-lik... 64 2e-08 ref|XP_004138379.1| PREDICTED: thioredoxin Y1, chloroplastic-lik... 64 2e-08 gb|EPS66138.1| hypothetical protein M569_08641, partial [Genlise... 62 1e-07 gb|EXC19875.1| Thioredoxin Y1 [Morus notabilis] 59 5e-07 ref|XP_002266350.1| PREDICTED: thioredoxin Y1, chloroplastic [Vi... 59 7e-07 gb|AFK40986.1| unknown [Lotus japonicus] 59 9e-07 gb|EYU17472.1| hypothetical protein MIMGU_mgv1a012969mg [Mimulus... 58 1e-06 ref|XP_006390157.1| hypothetical protein EUTSA_v10019218mg [Eutr... 58 2e-06 ref|XP_006473069.1| PREDICTED: thioredoxin Y1, chloroplastic-lik... 57 2e-06 ref|XP_007019531.1| Thioredoxin Y1 isoform 1 [Theobroma cacao] g... 57 2e-06 ref|NP_001237908.1| uncharacterized protein LOC100500683 [Glycin... 57 2e-06 ref|XP_002524295.1| thioredoxin m(mitochondrial)-type, putative ... 57 2e-06 gb|ACJ83856.1| unknown [Medicago truncatula] 57 2e-06 ref|XP_003592097.1| Thioredoxin-like protein [Medicago truncatul... 57 2e-06 ref|XP_004290507.1| PREDICTED: thioredoxin Y1, chloroplastic-lik... 57 3e-06 gb|AAF04439.1|AC010718_8 thioredoxin-like protein; 49720-48645 [... 57 3e-06 ref|XP_002889100.1| hypothetical protein ARALYDRAFT_476836 [Arab... 57 3e-06 ref|NP_177802.2| thioredoxin Y1 [Arabidopsis thaliana] gi|753243... 57 3e-06 ref|XP_006434475.1| hypothetical protein CICLE_v10002691mg [Citr... 57 3e-06 ref|XP_004496464.1| PREDICTED: thioredoxin Y1, chloroplastic-lik... 57 3e-06 >ref|XP_004166624.1| PREDICTED: thioredoxin Y1, chloroplastic-like [Cucumis sativus] Length = 74 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +1 Query: 1 LPTFILFRDGKPLDRFEGAMGAAELIQRVEASLQVKQ 111 LPTFILF+DGKPLDRFEGA+ A ELIQR+E SL+VKQ Sbjct: 38 LPTFILFKDGKPLDRFEGALAARELIQRIEDSLKVKQ 74 >ref|XP_004138379.1| PREDICTED: thioredoxin Y1, chloroplastic-like [Cucumis sativus] Length = 174 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +1 Query: 1 LPTFILFRDGKPLDRFEGAMGAAELIQRVEASLQVKQ 111 LPTFILF+DGKPLDRFEGA+ A ELIQR+E SL+VKQ Sbjct: 138 LPTFILFKDGKPLDRFEGALAARELIQRIEDSLKVKQ 174 >gb|EPS66138.1| hypothetical protein M569_08641, partial [Genlisea aurea] Length = 171 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +1 Query: 1 LPTFILFRDGKPLDRFEGAMGAAELIQRVEASL 99 LPTFILF+DGKPLDRFEGA+GA +L+QR+EASL Sbjct: 139 LPTFILFKDGKPLDRFEGALGAEQLVQRIEASL 171 >gb|EXC19875.1| Thioredoxin Y1 [Morus notabilis] Length = 175 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = +1 Query: 1 LPTFILFRDGKPLDRFEGAMGAAELIQRVEASLQVKQ 111 LPTFI+F+D KP DRFEGAM AA+LIQR+E +L++KQ Sbjct: 139 LPTFIIFKDAKPFDRFEGAMTAAQLIQRIEDALKIKQ 175 >ref|XP_002266350.1| PREDICTED: thioredoxin Y1, chloroplastic [Vitis vinifera] gi|296081192|emb|CBI18218.3| unnamed protein product [Vitis vinifera] Length = 175 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = +1 Query: 1 LPTFILFRDGKPLDRFEGAMGAAELIQRVEASLQVKQ 111 LPTFI+F+DGKP DRFEGA+ A +LIQR+E +L+VKQ Sbjct: 139 LPTFIIFKDGKPYDRFEGALTADQLIQRIETTLKVKQ 175 >gb|AFK40986.1| unknown [Lotus japonicus] Length = 168 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = +1 Query: 1 LPTFILFRDGKPLDRFEGAMGAAELIQRVEASLQVKQ 111 LPTFI+F+DG+P DRFEGA+ A +LI+R+E SL+VKQ Sbjct: 132 LPTFIIFKDGEPFDRFEGALAADQLIERIETSLKVKQ 168 >gb|EYU17472.1| hypothetical protein MIMGU_mgv1a012969mg [Mimulus guttatus] Length = 234 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 1 LPTFILFRDGKPLDRFEGAMGAAELIQRVEASL 99 LPTFILF++GKP DRFEGAMGA +LIQR+EASL Sbjct: 199 LPTFILFKNGKPHDRFEGAMGADQLIQRIEASL 231 >ref|XP_006390157.1| hypothetical protein EUTSA_v10019218mg [Eutrema salsugineum] gi|557086591|gb|ESQ27443.1| hypothetical protein EUTSA_v10019218mg [Eutrema salsugineum] Length = 173 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +1 Query: 1 LPTFILFRDGKPLDRFEGAMGAAELIQRVEASLQVK 108 LPTFILF+DG+P DRFEGA+ A +LIQR+E SL+VK Sbjct: 137 LPTFILFKDGEPCDRFEGALAAKQLIQRIEDSLKVK 172 >ref|XP_006473069.1| PREDICTED: thioredoxin Y1, chloroplastic-like [Citrus sinensis] Length = 169 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = +1 Query: 1 LPTFILFRDGKPLDRFEGAMGAAELIQRVEASLQVKQ 111 LPTFILF+DGKP DRFEGA +LIQR+E SL VKQ Sbjct: 133 LPTFILFKDGKPSDRFEGAFSKDQLIQRIENSLSVKQ 169 >ref|XP_007019531.1| Thioredoxin Y1 isoform 1 [Theobroma cacao] gi|590600761|ref|XP_007019532.1| Thioredoxin Y1 isoform 1 [Theobroma cacao] gi|508724859|gb|EOY16756.1| Thioredoxin Y1 isoform 1 [Theobroma cacao] gi|508724860|gb|EOY16757.1| Thioredoxin Y1 isoform 1 [Theobroma cacao] Length = 174 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +1 Query: 1 LPTFILFRDGKPLDRFEGAMGAAELIQRVEASLQVKQ 111 LPTFI+F+DGKP DRFEGA+ A LIQR+E SL VKQ Sbjct: 138 LPTFIIFKDGKPFDRFEGALTADLLIQRIENSLSVKQ 174 >ref|NP_001237908.1| uncharacterized protein LOC100500683 [Glycine max] gi|571562436|ref|XP_006605311.1| PREDICTED: uncharacterized protein LOC100500683 isoform X1 [Glycine max] gi|571562440|ref|XP_006605312.1| PREDICTED: uncharacterized protein LOC100500683 isoform X2 [Glycine max] gi|571562444|ref|XP_006605313.1| PREDICTED: uncharacterized protein LOC100500683 isoform X3 [Glycine max] gi|571562448|ref|XP_006605314.1| PREDICTED: uncharacterized protein LOC100500683 isoform X4 [Glycine max] gi|255630923|gb|ACU15824.1| unknown [Glycine max] Length = 175 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = +1 Query: 1 LPTFILFRDGKPLDRFEGAMGAAELIQRVEASLQVKQ 111 LPTFI+F+DG+P DRFEGA+ A +LI+R+EA L+VKQ Sbjct: 139 LPTFIMFKDGEPYDRFEGALTADQLIERIEAGLKVKQ 175 >ref|XP_002524295.1| thioredoxin m(mitochondrial)-type, putative [Ricinus communis] gi|223536386|gb|EEF38035.1| thioredoxin m(mitochondrial)-type, putative [Ricinus communis] Length = 170 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +1 Query: 1 LPTFILFRDGKPLDRFEGAMGAAELIQRVEASLQVKQ 111 LPTFI+F+DGKP DRFEGA+ I+R+E+SLQVKQ Sbjct: 134 LPTFIIFKDGKPYDRFEGALAKDRFIERIESSLQVKQ 170 >gb|ACJ83856.1| unknown [Medicago truncatula] Length = 169 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = +1 Query: 1 LPTFILFRDGKPLDRFEGAMGAAELIQRVEASLQVKQ 111 LPTFI+F+DGKP DRFEGA+ A +LI+R+E +L VKQ Sbjct: 133 LPTFIIFKDGKPFDRFEGALTADKLIERIETTLNVKQ 169 >ref|XP_003592097.1| Thioredoxin-like protein [Medicago truncatula] gi|355481145|gb|AES62348.1| Thioredoxin-like protein [Medicago truncatula] gi|388495092|gb|AFK35612.1| unknown [Medicago truncatula] Length = 169 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = +1 Query: 1 LPTFILFRDGKPLDRFEGAMGAAELIQRVEASLQVKQ 111 LPTFI+F+DGKP DRFEGA+ A +LI+R+E +L VKQ Sbjct: 133 LPTFIIFKDGKPFDRFEGALTADKLIERIETTLNVKQ 169 >ref|XP_004290507.1| PREDICTED: thioredoxin Y1, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 177 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/37 (64%), Positives = 33/37 (89%) Frame = +1 Query: 1 LPTFILFRDGKPLDRFEGAMGAAELIQRVEASLQVKQ 111 LPTFI+F+DG+P DRFEGA+ A +LI+R+E +L+VKQ Sbjct: 141 LPTFIIFKDGEPYDRFEGALNADQLIERIETALKVKQ 177 >gb|AAF04439.1|AC010718_8 thioredoxin-like protein; 49720-48645 [Arabidopsis thaliana] Length = 151 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +1 Query: 1 LPTFILFRDGKPLDRFEGAMGAAELIQRVEASLQVK 108 LPTFILF+DG+P DRFEGA+ A +LIQR+E SL+VK Sbjct: 115 LPTFILFKDGEPCDRFEGALTAKQLIQRIEDSLKVK 150 >ref|XP_002889100.1| hypothetical protein ARALYDRAFT_476836 [Arabidopsis lyrata subsp. lyrata] gi|297334941|gb|EFH65359.1| hypothetical protein ARALYDRAFT_476836 [Arabidopsis lyrata subsp. lyrata] Length = 157 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +1 Query: 1 LPTFILFRDGKPLDRFEGAMGAAELIQRVEASLQVK 108 LPTFILF+DG+P DRFEGA+ A +LIQR+E SL+VK Sbjct: 121 LPTFILFKDGEPCDRFEGALTAKQLIQRIEDSLKVK 156 >ref|NP_177802.2| thioredoxin Y1 [Arabidopsis thaliana] gi|75324340|sp|Q6NPF9.1|TRXY1_ARATH RecName: Full=Thioredoxin Y1, chloroplastic; Short=AtTrxy1; Flags: Precursor gi|38454080|gb|AAR20734.1| At1g76760 [Arabidopsis thaliana] gi|38604000|gb|AAR24743.1| At1g76760 [Arabidopsis thaliana] gi|110743067|dbj|BAE99426.1| thioredoxin-like protein [Arabidopsis thaliana] gi|332197765|gb|AEE35886.1| thioredoxin Y1 [Arabidopsis thaliana] Length = 172 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +1 Query: 1 LPTFILFRDGKPLDRFEGAMGAAELIQRVEASLQVK 108 LPTFILF+DG+P DRFEGA+ A +LIQR+E SL+VK Sbjct: 136 LPTFILFKDGEPCDRFEGALTAKQLIQRIEDSLKVK 171 >ref|XP_006434475.1| hypothetical protein CICLE_v10002691mg [Citrus clementina] gi|557536597|gb|ESR47715.1| hypothetical protein CICLE_v10002691mg [Citrus clementina] Length = 169 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = +1 Query: 1 LPTFILFRDGKPLDRFEGAMGAAELIQRVEASLQVKQ 111 LPTFILF+DGKP DRFEGA +LIQR+E SL VKQ Sbjct: 133 LPTFILFKDGKPSDRFEGAFTKDQLIQRIENSLSVKQ 169 >ref|XP_004496464.1| PREDICTED: thioredoxin Y1, chloroplastic-like [Cicer arietinum] Length = 165 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = +1 Query: 1 LPTFILFRDGKPLDRFEGAMGAAELIQRVEASLQVKQ 111 LPTFI+F+DGKP DRFEGA+ A +LI+R+E SL+V Q Sbjct: 129 LPTFIIFKDGKPFDRFEGALPADKLIERIETSLKVTQ 165