BLASTX nr result
ID: Mentha27_contig00016679
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00016679 (212 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27480.1| hypothetical protein MIMGU_mgv1a013272mg [Mimulus... 57 3e-06 ref|XP_007020382.1| Domain of Uncharacterized protein function, ... 56 5e-06 >gb|EYU27480.1| hypothetical protein MIMGU_mgv1a013272mg [Mimulus guttatus] Length = 225 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +3 Query: 129 RWITHYSSRHRILLVGEGDFSFSTCLA 209 RWI HYSS HRILLVGEGDFSFSTCLA Sbjct: 26 RWIKHYSSSHRILLVGEGDFSFSTCLA 52 >ref|XP_007020382.1| Domain of Uncharacterized protein function, putative [Theobroma cacao] gi|508720010|gb|EOY11907.1| Domain of Uncharacterized protein function, putative [Theobroma cacao] Length = 269 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +3 Query: 123 EDRWITHYSSRHRILLVGEGDFSFSTCLAK 212 E++WI HYSSRH ILLVGEGDFSF+ CLA+ Sbjct: 10 EEKWIKHYSSRHEILLVGEGDFSFAACLAR 39