BLASTX nr result
ID: Mentha27_contig00016171
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00016171 (692 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30384.1| hypothetical protein MIMGU_mgv1a011046mg [Mimulus... 59 2e-06 gb|EPS68098.1| hypothetical protein M569_06675 [Genlisea aurea] 57 8e-06 >gb|EYU30384.1| hypothetical protein MIMGU_mgv1a011046mg [Mimulus guttatus] Length = 294 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +2 Query: 5 DGDEESKDQWVEIISWEPRASVFHNFL 85 DGDEESKDQW+E+ISWEPRA VFHNFL Sbjct: 73 DGDEESKDQWLEVISWEPRAFVFHNFL 99 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/43 (65%), Positives = 33/43 (76%), Gaps = 10/43 (23%) Frame = +2 Query: 593 ILSWQ----------SKEECEYLINIAQPHMEKSTVVDSETGK 691 ++SW+ SKEECEYLI+IA+PHMEKSTVVDSETGK Sbjct: 85 VISWEPRAFVFHNFLSKEECEYLISIAEPHMEKSTVVDSETGK 127 >gb|EPS68098.1| hypothetical protein M569_06675 [Genlisea aurea] Length = 283 Score = 56.6 bits (135), Expect = 8e-06 Identities = 27/43 (62%), Positives = 33/43 (76%), Gaps = 10/43 (23%) Frame = +2 Query: 593 ILSWQ----------SKEECEYLINIAQPHMEKSTVVDSETGK 691 I+SW+ SKEECEYLIN+A+PHM+KSTVVDS+TGK Sbjct: 77 IISWEPRAFVYHNFLSKEECEYLINVAKPHMQKSTVVDSKTGK 119