BLASTX nr result
ID: Mentha27_contig00016113
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00016113 (711 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278668.2| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 emb|CBI16904.3| unnamed protein product [Vitis vinifera] 69 1e-09 emb|CAN67492.1| hypothetical protein VITISV_035978 [Vitis vinifera] 69 1e-09 ref|XP_007032935.1| Pentatricopeptide repeat (PPR) superfamily p... 68 3e-09 gb|EXB85809.1| hypothetical protein L484_009655 [Morus notabilis] 67 6e-09 ref|XP_004303223.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 gb|EYU44257.1| hypothetical protein MIMGU_mgv1a021838mg [Mimulus... 65 3e-08 ref|XP_006384245.1| hypothetical protein POPTR_0004s11010g [Popu... 65 3e-08 gb|ABD96900.1| hypothetical protein [Cleome spinosa] 65 3e-08 ref|XP_004137118.1| PREDICTED: pentatricopeptide repeat-containi... 64 5e-08 ref|XP_006482464.1| PREDICTED: pentatricopeptide repeat-containi... 64 6e-08 ref|XP_006430993.1| hypothetical protein CICLE_v10011041mg [Citr... 64 6e-08 gb|EPS63127.1| hypothetical protein M569_11659 [Genlisea aurea] 63 1e-07 ref|XP_006366808.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_007139372.1| hypothetical protein PHAVU_008G023900g [Phas... 62 2e-07 ref|XP_002533488.1| pentatricopeptide repeat-containing protein,... 62 2e-07 ref|XP_006299596.1| hypothetical protein CARUB_v10015774mg [Caps... 61 3e-07 gb|AAG12601.1|AC068900_7 hypothetical protein; 7123-4412 [Arabid... 61 4e-07 ref|XP_004242544.1| PREDICTED: pentatricopeptide repeat-containi... 61 4e-07 ref|XP_002884315.1| pentatricopeptide repeat-containing protein ... 61 4e-07 >ref|XP_002278668.2| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like [Vitis vinifera] Length = 877 Score = 69.3 bits (168), Expect = 1e-09 Identities = 30/46 (65%), Positives = 39/46 (84%) Frame = +3 Query: 36 LIQLDPRCSAAYVLLSQTYADAGMWDEASKMRRMMRSNGLKTKPGC 173 ++QL+P SAAYVLLS YA+AGMW+E +K+R+MMR NGLK +PGC Sbjct: 773 ILQLEPEDSAAYVLLSNIYANAGMWNEVTKLRKMMRFNGLKKEPGC 818 >emb|CBI16904.3| unnamed protein product [Vitis vinifera] Length = 843 Score = 69.3 bits (168), Expect = 1e-09 Identities = 30/46 (65%), Positives = 39/46 (84%) Frame = +3 Query: 36 LIQLDPRCSAAYVLLSQTYADAGMWDEASKMRRMMRSNGLKTKPGC 173 ++QL+P SAAYVLLS YA+AGMW+E +K+R+MMR NGLK +PGC Sbjct: 726 ILQLEPEDSAAYVLLSNIYANAGMWNEVTKLRKMMRFNGLKKEPGC 771 >emb|CAN67492.1| hypothetical protein VITISV_035978 [Vitis vinifera] Length = 814 Score = 69.3 bits (168), Expect = 1e-09 Identities = 30/46 (65%), Positives = 39/46 (84%) Frame = +3 Query: 36 LIQLDPRCSAAYVLLSQTYADAGMWDEASKMRRMMRSNGLKTKPGC 173 ++QL+P SAAYVLLS YA+AGMW+E +K+R+MMR NGLK +PGC Sbjct: 710 ILQLEPEDSAAYVLLSNIYANAGMWNEVTKLRKMMRFNGLKKEPGC 755 >ref|XP_007032935.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] gi|508711964|gb|EOY03861.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] Length = 860 Score = 68.2 bits (165), Expect = 3e-09 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = +3 Query: 36 LIQLDPRCSAAYVLLSQTYADAGMWDEASKMRRMMRSNGLKTKPGC 173 L+QLDP+ S+AY+LLS YADAGMWD+ S MR++MR N LK +PGC Sbjct: 748 LLQLDPQDSSAYILLSNIYADAGMWDKVSDMRKIMRYNKLKKEPGC 793 >gb|EXB85809.1| hypothetical protein L484_009655 [Morus notabilis] Length = 879 Score = 67.0 bits (162), Expect = 6e-09 Identities = 31/46 (67%), Positives = 37/46 (80%) Frame = +3 Query: 36 LIQLDPRCSAAYVLLSQTYADAGMWDEASKMRRMMRSNGLKTKPGC 173 L+QLDP+ SAAYVLLS YAD+GMW E S MRR M+S+ LK +PGC Sbjct: 772 LLQLDPQDSAAYVLLSNIYADSGMWGEMSNMRRAMKSHKLKKEPGC 817 >ref|XP_004303223.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like [Fragaria vesca subsp. vesca] Length = 857 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +3 Query: 42 QLDPRCSAAYVLLSQTYADAGMWDEASKMRRMMRSNGLKTKPGC 173 QLDP+ S+ YVLLS YA+AGMW E SKMRR MR +G+K +PGC Sbjct: 759 QLDPQDSSTYVLLSHIYAEAGMWGEVSKMRRRMRYDGMKKEPGC 802 >gb|EYU44257.1| hypothetical protein MIMGU_mgv1a021838mg [Mimulus guttatus] Length = 820 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/47 (59%), Positives = 38/47 (80%) Frame = +3 Query: 33 WLIQLDPRCSAAYVLLSQTYADAGMWDEASKMRRMMRSNGLKTKPGC 173 +L++LDP+ S+AYVLLS YADA MWD+ SKMR++MR +K +PGC Sbjct: 725 YLLRLDPQDSSAYVLLSNIYADAEMWDQVSKMRKIMRRGRMKKEPGC 771 >ref|XP_006384245.1| hypothetical protein POPTR_0004s11010g [Populus trichocarpa] gi|550340791|gb|ERP62042.1| hypothetical protein POPTR_0004s11010g [Populus trichocarpa] Length = 897 Score = 64.7 bits (156), Expect = 3e-08 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = +3 Query: 36 LIQLDPRCSAAYVLLSQTYADAGMWDEASKMRRMMRSNGLKTKPGC 173 L+QLDP+ S+A VLLS YADAGMW S+MR+MMR N LK +PGC Sbjct: 780 LLQLDPQDSSACVLLSNIYADAGMWGNVSEMRKMMRHNKLKKEPGC 825 >gb|ABD96900.1| hypothetical protein [Cleome spinosa] Length = 924 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/46 (60%), Positives = 38/46 (82%) Frame = +3 Query: 36 LIQLDPRCSAAYVLLSQTYADAGMWDEASKMRRMMRSNGLKTKPGC 173 L++LDP+ S+ Y+LLS YADAGMWD+AS++R MRS+ LK +PGC Sbjct: 807 LLRLDPQDSSTYILLSNIYADAGMWDKASELRTAMRSDKLKKEPGC 852 >ref|XP_004137118.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like [Cucumis sativus] gi|449528041|ref|XP_004171015.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like [Cucumis sativus] Length = 868 Score = 63.9 bits (154), Expect = 5e-08 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = +3 Query: 36 LIQLDPRCSAAYVLLSQTYADAGMWDEASKMRRMMRSNGLKTKPGC 173 L++LDP S+AY LLS YADAGMW + SK+R+ MRS+ LK +PGC Sbjct: 756 LLKLDPEDSSAYTLLSNIYADAGMWQQVSKIRQTMRSHNLKKEPGC 801 >ref|XP_006482464.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like [Citrus sinensis] Length = 892 Score = 63.5 bits (153), Expect = 6e-08 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = +3 Query: 36 LIQLDPRCSAAYVLLSQTYADAGMWDEASKMRRMMRSNGLKTKPGC 173 L+QLDP+ S+ Y+LLS YADAGMWD+ S RR+MR N ++ +PGC Sbjct: 777 LLQLDPQDSSTYILLSNIYADAGMWDKLSYTRRLMRQNKVRKEPGC 822 >ref|XP_006430993.1| hypothetical protein CICLE_v10011041mg [Citrus clementina] gi|557533050|gb|ESR44233.1| hypothetical protein CICLE_v10011041mg [Citrus clementina] Length = 888 Score = 63.5 bits (153), Expect = 6e-08 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = +3 Query: 36 LIQLDPRCSAAYVLLSQTYADAGMWDEASKMRRMMRSNGLKTKPGC 173 L+QLDP+ S+ Y+LLS YADAGMWD+ S RR+MR N ++ +PGC Sbjct: 777 LLQLDPQDSSTYILLSNIYADAGMWDKLSYTRRLMRQNKVRKEPGC 822 >gb|EPS63127.1| hypothetical protein M569_11659 [Genlisea aurea] Length = 864 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = +3 Query: 36 LIQLDPRCSAAYVLLSQTYADAGMWDEASKMRRMMRSNGLKTKPGC 173 L+++DP +AYVLLS YADAGMW E +K+RR MR G+K +PGC Sbjct: 779 LLEMDPNDPSAYVLLSNVYADAGMWGEVAKIRRTMRDWGMKKEPGC 824 >ref|XP_006366808.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like [Solanum tuberosum] Length = 894 Score = 62.0 bits (149), Expect = 2e-07 Identities = 26/46 (56%), Positives = 36/46 (78%) Frame = +3 Query: 36 LIQLDPRCSAAYVLLSQTYADAGMWDEASKMRRMMRSNGLKTKPGC 173 L++LDP S++++LLS YADAGMW E ++MR+ MR GLK +PGC Sbjct: 779 LLELDPEDSSSHILLSNIYADAGMWKEVAEMRKAMRYGGLKKEPGC 824 >ref|XP_007139372.1| hypothetical protein PHAVU_008G023900g [Phaseolus vulgaris] gi|561012505|gb|ESW11366.1| hypothetical protein PHAVU_008G023900g [Phaseolus vulgaris] Length = 891 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/48 (56%), Positives = 39/48 (81%) Frame = +3 Query: 30 AWLIQLDPRCSAAYVLLSQTYADAGMWDEASKMRRMMRSNGLKTKPGC 173 ++L+QLDP+ S+AYVLLS YA+AG+W E +K+R +M+S LK +PGC Sbjct: 774 SYLLQLDPQDSSAYVLLSNVYANAGIWSEVAKIRSIMKSCKLKKEPGC 821 >ref|XP_002533488.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223526650|gb|EEF28892.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 939 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = +3 Query: 36 LIQLDPRCSAAYVLLSQTYADAGMWDEASKMRRMMRSNGLKTKPGC 173 ++QL+P S+A +LLS YADAGMW + S+MR+MMR N LK +PGC Sbjct: 775 ILQLEPEDSSACILLSNIYADAGMWGKVSEMRKMMRYNKLKKEPGC 820 >ref|XP_006299596.1| hypothetical protein CARUB_v10015774mg [Capsella rubella] gi|482568305|gb|EOA32494.1| hypothetical protein CARUB_v10015774mg [Capsella rubella] Length = 1030 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = +3 Query: 30 AWLIQLDPRCSAAYVLLSQTYADAGMWDEASKMRRMMRSNGLKTKPGC 173 A L++LDP+ S+AY LLS YADAGMW++ S +RR MR LK +PGC Sbjct: 797 AALLRLDPQDSSAYTLLSNVYADAGMWEKVSDLRRSMRGFKLKKEPGC 844 >gb|AAG12601.1|AC068900_7 hypothetical protein; 7123-4412 [Arabidopsis thaliana] Length = 861 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = +3 Query: 30 AWLIQLDPRCSAAYVLLSQTYADAGMWDEASKMRRMMRSNGLKTKPGC 173 A L++LDP+ S+AY LLS YADAGMW++ S +RR MR LK +PGC Sbjct: 755 AALLRLDPQDSSAYTLLSNVYADAGMWEKVSDLRRNMRGFKLKKEPGC 802 >ref|XP_004242544.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like [Solanum lycopersicum] Length = 858 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/46 (56%), Positives = 36/46 (78%) Frame = +3 Query: 36 LIQLDPRCSAAYVLLSQTYADAGMWDEASKMRRMMRSNGLKTKPGC 173 L++LDP S++++LLS YA AGMW E S+MR++MR GLK +PGC Sbjct: 755 LLELDPEDSSSHILLSNIYAAAGMWKEVSEMRKVMRYGGLKKEPGC 800 >ref|XP_002884315.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297330155|gb|EFH60574.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 861 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = +3 Query: 30 AWLIQLDPRCSAAYVLLSQTYADAGMWDEASKMRRMMRSNGLKTKPGC 173 A L++LDP+ S+AY LLS YADAGMW++ S +RR MR LK +PGC Sbjct: 755 AALLRLDPQDSSAYTLLSNVYADAGMWEKVSDLRRNMRGFKLKKEPGC 802