BLASTX nr result
ID: Mentha27_contig00016028
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00016028 (391 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS58776.1| hypothetical protein M569_16037, partial [Genlise... 60 3e-07 >gb|EPS58776.1| hypothetical protein M569_16037, partial [Genlisea aurea] Length = 352 Score = 60.1 bits (144), Expect = 3e-07 Identities = 35/68 (51%), Positives = 39/68 (57%), Gaps = 1/68 (1%) Frame = +3 Query: 189 MELETPAKNTLWKQSSMAPERVYXXXXXXXXXXXXXXXXXX-PGLKLMYLVNGGDLDGIK 365 ME PAK TLW+QSSMA +R Y P LKLMYLVN GDL+GIK Sbjct: 1 METGAPAKFTLWRQSSMASDRDYEALIDLDLEQEDPDVADIDPRLKLMYLVNEGDLEGIK 60 Query: 366 ELLEAGLD 389 EL+ AG D Sbjct: 61 ELIAAGTD 68