BLASTX nr result
ID: Mentha27_contig00015978
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00015978 (203 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32614.1| hypothetical protein MIMGU_mgv1a023497mg, partial... 65 1e-08 gb|EYU43811.1| hypothetical protein MIMGU_mgv1a011652mg [Mimulus... 61 1e-07 >gb|EYU32614.1| hypothetical protein MIMGU_mgv1a023497mg, partial [Mimulus guttatus] Length = 235 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +2 Query: 65 NKDAFPSVETCFGILADNPELVMNHQSPVSVLE 163 NKDAFP+VETCFGIL+DNP L++NHQSPVSVLE Sbjct: 12 NKDAFPAVETCFGILSDNPGLILNHQSPVSVLE 44 >gb|EYU43811.1| hypothetical protein MIMGU_mgv1a011652mg [Mimulus guttatus] Length = 275 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = +2 Query: 65 NKDAFPSVETCFGILADNPELVMNHQSPVSVLE 163 NK+AFP+VETCFGIL+DNPEL+ +H+SPVSVLE Sbjct: 87 NKEAFPAVETCFGILSDNPELISSHKSPVSVLE 119