BLASTX nr result
ID: Mentha27_contig00015929
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00015929 (268 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006370824.1| hypothetical protein POPTR_0019s00380g [Popu... 61 1e-07 ref|XP_006370912.1| hypothetical protein POPTR_0019s01670g [Popu... 60 2e-07 ref|XP_006389248.1| hypothetical protein POPTR_0031s00200g [Popu... 59 5e-07 ref|XP_006389247.1| hypothetical protein POPTR_0031s00200g [Popu... 59 5e-07 ref|XP_006370964.1| hypothetical protein POPTR_0019s02180g [Popu... 59 9e-07 ref|XP_007021499.1| Nbs-lrr resistance protein [Theobroma cacao]... 58 1e-06 ref|XP_006389021.1| hypothetical protein POPTR_0060s00250g [Popu... 58 2e-06 ref|XP_006389018.1| hypothetical protein POPTR_0060s00220g [Popu... 57 3e-06 ref|XP_006370825.1| hypothetical protein POPTR_0019s00390g [Popu... 57 4e-06 ref|XP_002317526.2| hypothetical protein POPTR_0011s12620g [Popu... 56 5e-06 ref|XP_002325307.2| hypothetical protein POPTR_0019s00705g [Popu... 56 5e-06 ref|XP_006389286.1| hypothetical protein POPTR_0031s004401g, par... 56 5e-06 ref|XP_006370326.1| hypothetical protein POPTR_0001s41680g [Popu... 56 6e-06 ref|XP_006387704.1| hypothetical protein POPTR_0661s00220g [Popu... 56 6e-06 >ref|XP_006370824.1| hypothetical protein POPTR_0019s00380g [Populus trichocarpa] gi|550316365|gb|ERP48621.1| hypothetical protein POPTR_0019s00380g [Populus trichocarpa] Length = 248 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/72 (43%), Positives = 50/72 (69%), Gaps = 7/72 (9%) Frame = -1 Query: 196 KLRVLSLKELPRLRSVSNATMICNSIEEMYIKKCPRLMNKLPVDMTV------APPPSLR 35 KL++L L LP L+S+ +A +IC+S+E + ++KC +L +LP+ + + +PPPSL+ Sbjct: 159 KLKLLVLTGLPELKSICSAKLICDSLEVIGVRKCEKL-RRLPICLPLLENGQPSPPPSLK 217 Query: 34 YLCVD-REWWES 2 Y+ VD EWWES Sbjct: 218 YIKVDSEEWWES 229 >ref|XP_006370912.1| hypothetical protein POPTR_0019s01670g [Populus trichocarpa] gi|550316493|gb|ERP48709.1| hypothetical protein POPTR_0019s01670g [Populus trichocarpa] Length = 979 Score = 60.5 bits (145), Expect = 2e-07 Identities = 33/89 (37%), Positives = 53/89 (59%), Gaps = 6/89 (6%) Frame = -1 Query: 250 KSVAGKEETIRRWG*GPHKLRVLSLKELPRLRSVSNATMICNSIEEMYIKKCPRLMN--- 80 + V G+EE+ KLR+L L +LP+L+S+ +A +IC+S+EE+ + C L Sbjct: 871 EDVVGEEESSSNIEFKLPKLRILDLYDLPKLKSICSAKLICDSLEEILVSYCQELKRMGI 930 Query: 79 --KLPVDMTVAPPPSLRYLCV-DREWWES 2 +L + +PPPSL +C+ +EWWES Sbjct: 931 FPQLLENGQPSPPPSLVRICIYPKEWWES 959 >ref|XP_006389248.1| hypothetical protein POPTR_0031s00200g [Populus trichocarpa] gi|550312000|gb|ERP48162.1| hypothetical protein POPTR_0031s00200g [Populus trichocarpa] Length = 993 Score = 59.3 bits (142), Expect = 5e-07 Identities = 34/90 (37%), Positives = 55/90 (61%), Gaps = 7/90 (7%) Frame = -1 Query: 250 KSVAGKEETIRRWG*GPHKLRVLSLKELPRLRSVSNATMICNSIEEMYIKKCPRLMNKLP 71 K V G+E +G KLR L+L+ LP L+S+S+A +IC+S+E + + C +L ++P Sbjct: 874 KGVMGEESNNNSFGLKLPKLRELTLRGLPELKSISSAKLICDSLELIEVLYCEKL-KRMP 932 Query: 70 VDMTV------APPPSLRYLCV-DREWWES 2 + + + +PPPSLR + + EWWES Sbjct: 933 ICLPLLENGQPSPPPSLRRIEICPEEWWES 962 >ref|XP_006389247.1| hypothetical protein POPTR_0031s00200g [Populus trichocarpa] gi|550311999|gb|ERP48161.1| hypothetical protein POPTR_0031s00200g [Populus trichocarpa] Length = 869 Score = 59.3 bits (142), Expect = 5e-07 Identities = 34/90 (37%), Positives = 55/90 (61%), Gaps = 7/90 (7%) Frame = -1 Query: 250 KSVAGKEETIRRWG*GPHKLRVLSLKELPRLRSVSNATMICNSIEEMYIKKCPRLMNKLP 71 K V G+E +G KLR L+L+ LP L+S+S+A +IC+S+E + + C +L ++P Sbjct: 114 KGVMGEESNNNSFGLKLPKLRELTLRGLPELKSISSAKLICDSLELIEVLYCEKL-KRMP 172 Query: 70 VDMTV------APPPSLRYLCV-DREWWES 2 + + + +PPPSLR + + EWWES Sbjct: 173 ICLPLLENGQPSPPPSLRRIEICPEEWWES 202 >ref|XP_006370964.1| hypothetical protein POPTR_0019s02180g [Populus trichocarpa] gi|550316547|gb|ERP48761.1| hypothetical protein POPTR_0019s02180g [Populus trichocarpa] Length = 1092 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/72 (38%), Positives = 49/72 (68%), Gaps = 7/72 (9%) Frame = -1 Query: 196 KLRVLSLKELPRLRSVSNATMICNSIEEMYIKKCPRLMNKLPVDMTV------APPPSLR 35 KLR L L+ LP L+S+ +A +ICNS+E++ ++ C +L ++P+ + + +PPPSLR Sbjct: 1000 KLRTLRLRYLPELKSICSAKLICNSLEDITVEDCDKL-KRMPICLPLLENGQPSPPPSLR 1058 Query: 34 YLCV-DREWWES 2 + + +EWWE+ Sbjct: 1059 RMNIKSKEWWET 1070 >ref|XP_007021499.1| Nbs-lrr resistance protein [Theobroma cacao] gi|508721127|gb|EOY13024.1| Nbs-lrr resistance protein [Theobroma cacao] Length = 1501 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/76 (38%), Positives = 52/76 (68%), Gaps = 11/76 (14%) Frame = -1 Query: 196 KLRVLSLKELPRLRSV--SNATMICNSIEEMYIKKCPRLMNKLPVDMTV--------APP 47 KL+VL+L +LP+L+S+ +N IC+S++ + I+ C R + ++P+ + + +PP Sbjct: 1397 KLKVLTLSDLPQLKSICKTNDVRICDSLQRIEIRNC-RKLKRIPLYLPLLELDNSQPSPP 1455 Query: 46 PSLRYLCVD-REWWES 2 PSL+ +C+D +EWWES Sbjct: 1456 PSLKEICIDPKEWWES 1471 >ref|XP_006389021.1| hypothetical protein POPTR_0060s00250g [Populus trichocarpa] gi|550311599|gb|ERP47935.1| hypothetical protein POPTR_0060s00250g [Populus trichocarpa] Length = 1031 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/72 (40%), Positives = 48/72 (66%), Gaps = 7/72 (9%) Frame = -1 Query: 196 KLRVLSLKELPRLRSVSNATMICNSIEEMYIKKCPRLMNKLPVDMTV------APPPSLR 35 KLR L L ELP L+S+ +A +ICNS+E++ ++ C +L ++P+ + + +PPPSL+ Sbjct: 941 KLRTLRLFELPELKSICSAKLICNSLEDIDVEDCQKL-KRMPICLPLLENDQPSPPPSLK 999 Query: 34 YLCV-DREWWES 2 + V EWWE+ Sbjct: 1000 EITVYPEEWWET 1011 >ref|XP_006389018.1| hypothetical protein POPTR_0060s00220g [Populus trichocarpa] gi|550311596|gb|ERP47932.1| hypothetical protein POPTR_0060s00220g [Populus trichocarpa] Length = 892 Score = 57.0 bits (136), Expect = 3e-06 Identities = 32/71 (45%), Positives = 44/71 (61%), Gaps = 6/71 (8%) Frame = -1 Query: 196 KLRVLSLKELPRLRSVSNATMICNSIEEMYIKKC---PRLMNKLPV--DMTVAPPPSLRY 32 KLR L L ELP L+S+ NA +ICNS+E++ I C R+ LP+ + +PPPSL Sbjct: 797 KLRTLKLSELPELKSICNAKLICNSLEDITIMFCVELKRMAISLPLLENGQPSPPPSLEE 856 Query: 31 LCV-DREWWES 2 + V EWWE+ Sbjct: 857 IIVYPEEWWET 867 >ref|XP_006370825.1| hypothetical protein POPTR_0019s00390g [Populus trichocarpa] gi|550316366|gb|ERP48622.1| hypothetical protein POPTR_0019s00390g [Populus trichocarpa] Length = 930 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/72 (38%), Positives = 48/72 (66%), Gaps = 7/72 (9%) Frame = -1 Query: 196 KLRVLSLKELPRLRSVSNATMICNSIEEMYIKKCPRLMNKLPVDMTV------APPPSLR 35 KLR + L+ LP L+S+ +A +IC+SIE + ++ C +L ++P+ + + +PPPSLR Sbjct: 785 KLRNMELRGLPELKSICSAKLICDSIEGIEVRNCEKL-KRMPICLPLLENGEPSPPPSLR 843 Query: 34 YLCVD-REWWES 2 + ++ EWWES Sbjct: 844 RMYIEPEEWWES 855 >ref|XP_002317526.2| hypothetical protein POPTR_0011s12620g [Populus trichocarpa] gi|566195134|ref|XP_006377779.1| hypothetical protein POPTR_0011s12620g [Populus trichocarpa] gi|566195136|ref|XP_006377780.1| hypothetical protein POPTR_0011s12620g [Populus trichocarpa] gi|550328240|gb|EEE98138.2| hypothetical protein POPTR_0011s12620g [Populus trichocarpa] gi|550328241|gb|ERP55576.1| hypothetical protein POPTR_0011s12620g [Populus trichocarpa] gi|550328242|gb|ERP55577.1| hypothetical protein POPTR_0011s12620g [Populus trichocarpa] Length = 957 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/71 (39%), Positives = 47/71 (66%), Gaps = 7/71 (9%) Frame = -1 Query: 193 LRVLSLKELPRLRSVSNATMICNSIEEMYIKKCPRLMNKLPVDMTV------APPPSLRY 32 LR L+ LP+L+S+ +A +IC S++++ ++ CP+L ++P+ + V PPPSL Sbjct: 851 LRRLNFVYLPKLKSICSAKLICGSLQKIRVRDCPKL-KRIPICLPVLDSGQPCPPPSLEE 909 Query: 31 LCVD-REWWES 2 + VD +EWWES Sbjct: 910 IDVDPKEWWES 920 >ref|XP_002325307.2| hypothetical protein POPTR_0019s00705g [Populus trichocarpa] gi|550316396|gb|EEE99688.2| hypothetical protein POPTR_0019s00705g [Populus trichocarpa] Length = 527 Score = 56.2 bits (134), Expect = 5e-06 Identities = 35/83 (42%), Positives = 49/83 (59%), Gaps = 6/83 (7%) Frame = -1 Query: 232 EETIRRWG*GPHKLRVLSLKELPRLRSVSNATMICNSIEEMYIKKCPRLMNK---LPV-- 68 EE+I G KLR L L+ LP L+S+ +A +ICNS++ + I KC +L LP+ Sbjct: 388 EESITNTGFNLPKLRHLRLRGLPELKSICSAKLICNSLQFICIIKCEKLKRMGICLPLLE 447 Query: 67 DMTVAPPPSLRYL-CVDREWWES 2 + +PPPSLR + EWWES Sbjct: 448 NGQPSPPPSLRTITAYPEEWWES 470 >ref|XP_006389286.1| hypothetical protein POPTR_0031s004401g, partial [Populus trichocarpa] gi|550312038|gb|ERP48200.1| hypothetical protein POPTR_0031s004401g, partial [Populus trichocarpa] Length = 105 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/72 (40%), Positives = 47/72 (65%), Gaps = 7/72 (9%) Frame = -1 Query: 196 KLRVLSLKELPRLRSVSNATMICNSIEEMYIKKCPRLMNKLPVDMTV------APPPSLR 35 KLR L+L ELP L S+ +A +IC+S++E+ + C +L ++P+ + + +PPPSL Sbjct: 13 KLRGLTLIELPELESICSAKLICDSLKEIAVYNCKKL-KRMPICLPLLENGQPSPPPSLE 71 Query: 34 YLCVD-REWWES 2 + +D EWWES Sbjct: 72 EIYIDSEEWWES 83 >ref|XP_006370326.1| hypothetical protein POPTR_0001s41680g [Populus trichocarpa] gi|550349505|gb|ERP66895.1| hypothetical protein POPTR_0001s41680g [Populus trichocarpa] Length = 751 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/72 (40%), Positives = 46/72 (63%), Gaps = 7/72 (9%) Frame = -1 Query: 196 KLRVLSLKELPRLRSVSNATMICNSIEEMYIKKCPRLMNKLPVDMTV------APPPSLR 35 KLR LS LP L+S+ +IC+S++ + ++ CP+L ++P+ + V +PPPSL Sbjct: 639 KLRHLSFILLPELKSICRENLICSSLQTIIVRDCPKL-KRMPLCLPVLDNGRPSPPPSLE 697 Query: 34 YLCVD-REWWES 2 + VD +EWWES Sbjct: 698 EIYVDPKEWWES 709 >ref|XP_006387704.1| hypothetical protein POPTR_0661s00220g [Populus trichocarpa] gi|550308201|gb|ERP46618.1| hypothetical protein POPTR_0661s00220g [Populus trichocarpa] Length = 644 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/72 (40%), Positives = 47/72 (65%), Gaps = 7/72 (9%) Frame = -1 Query: 196 KLRVLSLKELPRLRSVSNATMICNSIEEMYIKKCPRLMNKLPVDMTV------APPPSLR 35 KLR L L LP L+S+ +A +IC+S+E + + C +L ++P+ +++ +PPPSLR Sbjct: 552 KLRSLKLIRLPELKSICSAKLICDSLEVIDVYNCEKL-KRIPICLSLLENGEPSPPPSLR 610 Query: 34 YLCV-DREWWES 2 + + REWWES Sbjct: 611 NIVIKPREWWES 622