BLASTX nr result
ID: Mentha27_contig00015795
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00015795 (471 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006340116.1| PREDICTED: spermidine synthase 1-like [Solan... 91 1e-16 sp|O48659.1|SPD2_HYONI RecName: Full=Spermidine synthase 2; Shor... 90 3e-16 ref|XP_004237263.1| PREDICTED: spermidine synthase 1-like [Solan... 90 4e-16 sp|Q96556.1|SPD1_DATST RecName: Full=Spermidine synthase 1; Shor... 90 4e-16 gb|EPS71978.1| spermidine synthase 1, partial [Genlisea aurea] 84 2e-14 gb|EYU31283.1| hypothetical protein MIMGU_mgv1a010658mg [Mimulus... 84 2e-14 gb|AHL84162.1| spermidine synthase [Nicotiana tabacum] 84 2e-14 gb|AGW82430.1| spermidine synthase [Camellia sinensis] 84 2e-14 gb|ABK81124.1| spermidine synthase [Nicotiana tabacum] 84 2e-14 gb|AFF18802.1| spermidine synthase, partial [Dimocarpus longan] 83 4e-14 gb|EYU22481.1| hypothetical protein MIMGU_mgv1a010375mg [Mimulus... 82 1e-13 ref|XP_006302420.1| hypothetical protein CARUB_v10020501mg, part... 82 1e-13 sp|O48660.1|SPDE_NICSY RecName: Full=Spermidine synthase; AltNam... 82 1e-13 ref|XP_002888767.1| hypothetical protein ARALYDRAFT_476155 [Arab... 81 2e-13 emb|CAJ46252.1| putrescine N-methyltransferase [Calystegia sepium] 79 5e-13 ref|XP_007044553.1| Spermidine synthase 1 [Theobroma cacao] gi|5... 79 6e-13 gb|ACZ73829.1| spermidine synthase [Olea europaea] 79 6e-13 dbj|BAF91875.1| spermidine synthase [Nicotiana benthamiana] 79 6e-13 ref|XP_006438425.1| hypothetical protein CICLE_v10031988mg [Citr... 78 1e-12 sp|Q96557.1|SPD2_DATST RecName: Full=Spermidine synthase 2; Shor... 77 2e-12 >ref|XP_006340116.1| PREDICTED: spermidine synthase 1-like [Solanum tuberosum] Length = 309 Score = 91.3 bits (225), Expect = 1e-16 Identities = 38/49 (77%), Positives = 47/49 (95%) Frame = +1 Query: 55 LVPNLEGPSVDFKNPVNPIDADESHTKTKGPLRFYNSELHSAAFCLPSF 201 +V + EGP+VDFKNP+NPIDAD+SHTKT+GPL+FYNSE+HSA+FCLPSF Sbjct: 251 MVCSTEGPAVDFKNPINPIDADDSHTKTRGPLKFYNSEIHSASFCLPSF 299 >sp|O48659.1|SPD2_HYONI RecName: Full=Spermidine synthase 2; Short=SPDSY 2; AltName: Full=Putrescine aminopropyltransferase 2 gi|2821957|dbj|BAA24534.1| spermidine synthase 2 [Hyoscyamus niger] Length = 308 Score = 90.1 bits (222), Expect = 3e-16 Identities = 37/44 (84%), Positives = 44/44 (100%) Frame = +1 Query: 70 EGPSVDFKNPVNPIDADESHTKTKGPLRFYNSELHSAAFCLPSF 201 EGP+VDFKNP+NPIDAD+SHTKT+GPL+FYNSE+HSA+FCLPSF Sbjct: 255 EGPAVDFKNPINPIDADDSHTKTRGPLKFYNSEIHSASFCLPSF 298 >ref|XP_004237263.1| PREDICTED: spermidine synthase 1-like [Solanum lycopersicum] Length = 309 Score = 89.7 bits (221), Expect = 4e-16 Identities = 37/49 (75%), Positives = 46/49 (93%) Frame = +1 Query: 55 LVPNLEGPSVDFKNPVNPIDADESHTKTKGPLRFYNSELHSAAFCLPSF 201 +V + EGP+VDFKNP+NPID D+SHTKT+GPL+FYNSE+HSA+FCLPSF Sbjct: 251 MVCSTEGPAVDFKNPINPIDVDDSHTKTRGPLKFYNSEIHSASFCLPSF 299 >sp|Q96556.1|SPD1_DATST RecName: Full=Spermidine synthase 1; Short=SPDSY 1; AltName: Full=Putrescine aminopropyltransferase 1 gi|1561577|emb|CAA69420.1| spermidine synthase 1 [Datura stramonium] Length = 308 Score = 89.7 bits (221), Expect = 4e-16 Identities = 36/44 (81%), Positives = 44/44 (100%) Frame = +1 Query: 70 EGPSVDFKNPVNPIDADESHTKTKGPLRFYNSELHSAAFCLPSF 201 EGP+VDFKNP+NP+DAD+SHTKT+GPL+FYNSE+HSA+FCLPSF Sbjct: 255 EGPAVDFKNPINPVDADDSHTKTRGPLKFYNSEIHSASFCLPSF 298 >gb|EPS71978.1| spermidine synthase 1, partial [Genlisea aurea] Length = 301 Score = 84.3 bits (207), Expect = 2e-14 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = +1 Query: 73 GPSVDFKNPVNPIDADESHTKTKGPLRFYNSELHSAAFCLPSF 201 GP+VDFK+PVNPID D+SH +TKGPLRFYNSE+HSAAFCLPSF Sbjct: 257 GPAVDFKHPVNPIDDDDSHVETKGPLRFYNSEIHSAAFCLPSF 299 >gb|EYU31283.1| hypothetical protein MIMGU_mgv1a010658mg [Mimulus guttatus] Length = 306 Score = 84.0 bits (206), Expect = 2e-14 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = +1 Query: 70 EGPSVDFKNPVNPIDADESHTKTKGPLRFYNSELHSAAFCLPSF 201 EGP+VDFKNP+N ID DESH KT GPL+FYNSE+HSAAFCLPSF Sbjct: 258 EGPAVDFKNPINRIDDDESHVKTNGPLKFYNSEIHSAAFCLPSF 301 >gb|AHL84162.1| spermidine synthase [Nicotiana tabacum] Length = 345 Score = 84.0 bits (206), Expect = 2e-14 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = +1 Query: 70 EGPSVDFKNPVNPIDADESHTKTKGPLRFYNSELHSAAFCLPSF 201 EGP+VDFKNP+NPIDAD SH KT GP++FYNSELH A+FCLPSF Sbjct: 292 EGPAVDFKNPINPIDADASHNKTLGPMKFYNSELHKASFCLPSF 335 >gb|AGW82430.1| spermidine synthase [Camellia sinensis] Length = 329 Score = 84.0 bits (206), Expect = 2e-14 Identities = 35/44 (79%), Positives = 42/44 (95%) Frame = +1 Query: 70 EGPSVDFKNPVNPIDADESHTKTKGPLRFYNSELHSAAFCLPSF 201 EGP VDFK+PVNPIDAD+SH K+KGPL+FYNSE+H+A+FCLPSF Sbjct: 276 EGPPVDFKHPVNPIDADDSHCKSKGPLKFYNSEIHAASFCLPSF 319 >gb|ABK81124.1| spermidine synthase [Nicotiana tabacum] Length = 174 Score = 84.0 bits (206), Expect = 2e-14 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = +1 Query: 70 EGPSVDFKNPVNPIDADESHTKTKGPLRFYNSELHSAAFCLPSF 201 EGP+VDFKNP+NPIDAD SH KT GP++FYNSELH A+FCLPSF Sbjct: 99 EGPAVDFKNPINPIDADASHNKTLGPMKFYNSELHKASFCLPSF 142 >gb|AFF18802.1| spermidine synthase, partial [Dimocarpus longan] Length = 165 Score = 82.8 bits (203), Expect = 4e-14 Identities = 34/44 (77%), Positives = 42/44 (95%) Frame = +1 Query: 70 EGPSVDFKNPVNPIDADESHTKTKGPLRFYNSELHSAAFCLPSF 201 EGP VDFK+PVNPIDAD +H+K++GPL+FYNSE+HSAAFCLP+F Sbjct: 114 EGPPVDFKHPVNPIDADNNHSKSRGPLKFYNSEIHSAAFCLPTF 157 >gb|EYU22481.1| hypothetical protein MIMGU_mgv1a010375mg [Mimulus guttatus] Length = 314 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = +1 Query: 70 EGPSVDFKNPVNPIDADESHTKTKGPLRFYNSELHSAAFCLPSF 201 EGP VDFK PVNPIDAD+S + KGPLRFYNSE+HSAAFCLPSF Sbjct: 262 EGPDVDFKRPVNPIDADDSLAQAKGPLRFYNSEIHSAAFCLPSF 305 >ref|XP_006302420.1| hypothetical protein CARUB_v10020501mg, partial [Capsella rubella] gi|482571130|gb|EOA35318.1| hypothetical protein CARUB_v10020501mg, partial [Capsella rubella] Length = 368 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = +1 Query: 70 EGPSVDFKNPVNPIDADESHTKTKGPLRFYNSELHSAAFCLPSF 201 EGP VDFK PVNPIDADES K+ GPLRFYN+E+HSAAFCLPSF Sbjct: 314 EGPQVDFKKPVNPIDADESSIKSHGPLRFYNAEIHSAAFCLPSF 357 >sp|O48660.1|SPDE_NICSY RecName: Full=Spermidine synthase; AltName: Full=Putrescine aminopropyltransferase; Short=Aminopropyltransferase gi|2821959|dbj|BAA24535.1| spermidine synthase [Nicotiana sylvestris] Length = 314 Score = 81.6 bits (200), Expect = 1e-13 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = +1 Query: 70 EGPSVDFKNPVNPIDADESHTKTKGPLRFYNSELHSAAFCLPSF 201 EGP+VDFKNP+NPID D SH KT GP++FYNSELH A+FCLPSF Sbjct: 261 EGPAVDFKNPINPIDDDASHNKTLGPMKFYNSELHKASFCLPSF 304 >ref|XP_002888767.1| hypothetical protein ARALYDRAFT_476155 [Arabidopsis lyrata subsp. lyrata] gi|297334608|gb|EFH65026.1| hypothetical protein ARALYDRAFT_476155 [Arabidopsis lyrata subsp. lyrata] Length = 340 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = +1 Query: 70 EGPSVDFKNPVNPIDADESHTKTKGPLRFYNSELHSAAFCLPSF 201 EGP VDFK PVNPIDADES +K+ GPL+FYN+E+HSAAFCLPSF Sbjct: 287 EGPHVDFKKPVNPIDADESSSKSHGPLKFYNAEIHSAAFCLPSF 330 >emb|CAJ46252.1| putrescine N-methyltransferase [Calystegia sepium] Length = 344 Score = 79.3 bits (194), Expect = 5e-13 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = +1 Query: 70 EGPSVDFKNPVNPIDADESHTKTKGPLRFYNSELHSAAFCLPSF 201 EGP VDFKNPVNPID D SH K+KGPL+FYN+E+H AAF LPSF Sbjct: 295 EGPDVDFKNPVNPIDKDTSHVKSKGPLKFYNAEIHKAAFTLPSF 338 >ref|XP_007044553.1| Spermidine synthase 1 [Theobroma cacao] gi|508708488|gb|EOY00385.1| Spermidine synthase 1 [Theobroma cacao] Length = 346 Score = 79.0 bits (193), Expect = 6e-13 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = +1 Query: 70 EGPSVDFKNPVNPIDADESHTKTKGPLRFYNSELHSAAFCLPSF 201 EGP VDFK+PVNPID+D+S K+K PLRFYNSE+HSAAFCLPSF Sbjct: 294 EGPPVDFKHPVNPIDSDDSCCKSKRPLRFYNSEIHSAAFCLPSF 337 >gb|ACZ73829.1| spermidine synthase [Olea europaea] Length = 337 Score = 79.0 bits (193), Expect = 6e-13 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = +1 Query: 70 EGPSVDFKNPVNPIDADESHTKTKGPLRFYNSELHSAAFCLPSF 201 EGP+VDFK+P+NPIDAD SH TK PL+FYNSE+HSAAFCLP F Sbjct: 284 EGPAVDFKHPINPIDADCSHVNTKRPLKFYNSEMHSAAFCLPLF 327 >dbj|BAF91875.1| spermidine synthase [Nicotiana benthamiana] Length = 279 Score = 79.0 bits (193), Expect = 6e-13 Identities = 35/45 (77%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = +1 Query: 70 EGPSVDFKNPVNPIDADE-SHTKTKGPLRFYNSELHSAAFCLPSF 201 EGP+VDFKNP+NPID D+ SH KT GPL+FYNSELH A+FCLPSF Sbjct: 234 EGPAVDFKNPINPIDDDDVSHNKTLGPLKFYNSELHKASFCLPSF 278 >ref|XP_006438425.1| hypothetical protein CICLE_v10031988mg [Citrus clementina] gi|568860644|ref|XP_006483825.1| PREDICTED: spermidine synthase-like [Citrus sinensis] gi|557540621|gb|ESR51665.1| hypothetical protein CICLE_v10031988mg [Citrus clementina] Length = 345 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/45 (75%), Positives = 41/45 (91%), Gaps = 1/45 (2%) Frame = +1 Query: 70 EGPSVDFKNPVNPIDADESH-TKTKGPLRFYNSELHSAAFCLPSF 201 EGP VDFK+PVNPIDAD+SH +KGPL+FYNSE+H+AAFCLP+F Sbjct: 289 EGPPVDFKHPVNPIDADDSHCNSSKGPLKFYNSEIHTAAFCLPTF 333 >sp|Q96557.1|SPD2_DATST RecName: Full=Spermidine synthase 2; Short=SPDSY 2; AltName: Full=Putrescine aminopropyltransferase 2 gi|1561579|emb|CAA69421.1| spermidine synthase 2 [Datura stramonium] Length = 317 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/44 (77%), Positives = 40/44 (90%) Frame = +1 Query: 70 EGPSVDFKNPVNPIDADESHTKTKGPLRFYNSELHSAAFCLPSF 201 EGP+VDFKNP+NPID DESH +T GPL+FYNSE+H A+FCLPSF Sbjct: 265 EGPAVDFKNPINPID-DESHGQTIGPLKFYNSEIHQASFCLPSF 307