BLASTX nr result
ID: Mentha27_contig00015788
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00015788 (286 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24351.1| hypothetical protein MIMGU_mgv1a025953mg [Mimulus... 56 6e-06 >gb|EYU24351.1| hypothetical protein MIMGU_mgv1a025953mg [Mimulus guttatus] Length = 567 Score = 55.8 bits (133), Expect = 6e-06 Identities = 37/83 (44%), Positives = 49/83 (59%), Gaps = 3/83 (3%) Frame = -1 Query: 286 RIADAAYAAEDVIESHIVNRILPPGS--QHPIFGFFNYFRAPKKPENIPFSEDDQTSL-Y 116 RIA AAYAAEDVIESH+V+RI P GS H + + + E++ S+ Sbjct: 64 RIASAAYAAEDVIESHVVDRIQPAGSVEVHRLRKVVKDIMHSMRLKKARKEENNAGSISM 123 Query: 115 EDLQRVIEEMESIKKLMVEINAE 47 DLQ VIE+M+SIKK ++E E Sbjct: 124 LDLQAVIEDMDSIKKKVIEFRDE 146