BLASTX nr result
ID: Mentha27_contig00015569
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00015569 (264 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001241009.1| uncharacterized protein LOC100812176 [Glycin... 80 2e-13 ref|NP_001238505.1| uncharacterized protein LOC100500208 [Glycin... 80 2e-13 ref|XP_007138200.1| hypothetical protein PHAVU_009G188900g [Phas... 80 3e-13 ref|XP_004138121.1| PREDICTED: 39S ribosomal protein L47, mitoch... 79 5e-13 gb|EXC31172.1| 39S ribosomal protein L47 [Morus notabilis] 79 7e-13 ref|XP_002283452.1| PREDICTED: 39S ribosomal protein L47, mitoch... 79 7e-13 ref|NP_001056673.1| Os06g0128500 [Oryza sativa Japonica Group] g... 79 9e-13 gb|EEC79917.1| hypothetical protein OsI_21467 [Oryza sativa Indi... 79 9e-13 ref|XP_002436394.1| hypothetical protein SORBIDRAFT_10g001740 [S... 78 1e-12 gb|ACL54048.1| unknown [Zea mays] gi|413953417|gb|AFW86066.1| 39... 78 1e-12 gb|ACG35150.1| 39S ribosomal protein L47 [Zea mays] 78 1e-12 ref|NP_001147665.1| 39S ribosomal protein L47 [Zea mays] gi|1956... 78 1e-12 ref|XP_006655739.1| PREDICTED: 39S ribosomal protein L47, mitoch... 77 2e-12 ref|XP_006439758.1| hypothetical protein CICLE_v10022742mg [Citr... 77 2e-12 ref|XP_006417761.1| hypothetical protein EUTSA_v10009035mg [Eutr... 77 2e-12 ref|XP_004964406.1| PREDICTED: 39S ribosomal protein L47, mitoch... 77 2e-12 ref|XP_006292012.1| hypothetical protein CARUB_v10018201mg [Caps... 77 2e-12 ref|XP_002889667.1| ribosomal protein L29 family protein [Arabid... 77 2e-12 ref|XP_006476735.1| PREDICTED: 39S ribosomal protein L47, mitoch... 77 3e-12 ref|XP_006345029.1| PREDICTED: 39S ribosomal protein L47, mitoch... 77 3e-12 >ref|NP_001241009.1| uncharacterized protein LOC100812176 [Glycine max] gi|255640572|gb|ACU20571.1| unknown [Glycine max] Length = 143 Score = 80.5 bits (197), Expect = 2e-13 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 263 PERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINA 144 PERI KVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINA Sbjct: 103 PERIPKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINA 142 >ref|NP_001238505.1| uncharacterized protein LOC100500208 [Glycine max] gi|255629706|gb|ACU15202.1| unknown [Glycine max] Length = 142 Score = 80.5 bits (197), Expect = 2e-13 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 263 PERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINA 144 PERI KVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINA Sbjct: 102 PERIPKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINA 141 >ref|XP_007138200.1| hypothetical protein PHAVU_009G188900g [Phaseolus vulgaris] gi|561011287|gb|ESW10194.1| hypothetical protein PHAVU_009G188900g [Phaseolus vulgaris] Length = 142 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -2 Query: 263 PERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINA 144 PERISKVRKSMCRIKHVLTERAIEEPDPRRSA+MK+MINA Sbjct: 102 PERISKVRKSMCRIKHVLTERAIEEPDPRRSADMKKMINA 141 >ref|XP_004138121.1| PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Cucumis sativus] gi|449528917|ref|XP_004171448.1| PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Cucumis sativus] Length = 143 Score = 79.3 bits (194), Expect = 5e-13 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -2 Query: 263 PERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINA 144 PERI KVRKSMCRIKHVLTERAI+EPDPRRSAEMKRMINA Sbjct: 103 PERIPKVRKSMCRIKHVLTERAIDEPDPRRSAEMKRMINA 142 >gb|EXC31172.1| 39S ribosomal protein L47 [Morus notabilis] Length = 143 Score = 79.0 bits (193), Expect = 7e-13 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -2 Query: 263 PERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMIN 147 PERI KVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMIN Sbjct: 103 PERIPKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMIN 141 >ref|XP_002283452.1| PREDICTED: 39S ribosomal protein L47, mitochondrial isoform 1 [Vitis vinifera] gi|225457112|ref|XP_002283459.1| PREDICTED: 39S ribosomal protein L47, mitochondrial isoform 2 [Vitis vinifera] gi|297733826|emb|CBI15073.3| unnamed protein product [Vitis vinifera] Length = 140 Score = 79.0 bits (193), Expect = 7e-13 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 263 PERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINA 144 PERI KVRKSMCRIKHVLTERAIEEPDPRRS EMKRMINA Sbjct: 100 PERIPKVRKSMCRIKHVLTERAIEEPDPRRSVEMKRMINA 139 >ref|NP_001056673.1| Os06g0128500 [Oryza sativa Japonica Group] gi|52075615|dbj|BAD44786.1| ribosomal protein L29 protein-like [Oryza sativa Japonica Group] gi|113594713|dbj|BAF18587.1| Os06g0128500 [Oryza sativa Japonica Group] gi|215765035|dbj|BAG86732.1| unnamed protein product [Oryza sativa Japonica Group] gi|215768582|dbj|BAH00811.1| unnamed protein product [Oryza sativa Japonica Group] Length = 145 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 263 PERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINA 144 PER+SKV+KSMCRIKHVLTERAI EPDPRRSAEMKRMINA Sbjct: 105 PERVSKVKKSMCRIKHVLTERAIAEPDPRRSAEMKRMINA 144 >gb|EEC79917.1| hypothetical protein OsI_21467 [Oryza sativa Indica Group] gi|222634889|gb|EEE65021.1| hypothetical protein OsJ_19975 [Oryza sativa Japonica Group] Length = 291 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 263 PERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINA 144 PER+SKV+KSMCRIKHVLTERAI EPDPRRSAEMKRMINA Sbjct: 251 PERVSKVKKSMCRIKHVLTERAIAEPDPRRSAEMKRMINA 290 >ref|XP_002436394.1| hypothetical protein SORBIDRAFT_10g001740 [Sorghum bicolor] gi|241914617|gb|EER87761.1| hypothetical protein SORBIDRAFT_10g001740 [Sorghum bicolor] Length = 146 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 263 PERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINA 144 PERISKV+KSMCRIKHVLTERAI EPDPRRS+EMKRMINA Sbjct: 106 PERISKVKKSMCRIKHVLTERAIAEPDPRRSSEMKRMINA 145 >gb|ACL54048.1| unknown [Zea mays] gi|413953417|gb|AFW86066.1| 39S ribosomal protein L47 isoform 1 [Zea mays] gi|413953418|gb|AFW86067.1| 39S ribosomal protein L47 isoform 2 [Zea mays] Length = 138 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 263 PERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINA 144 PERISKV+KSMCRIKHVLTERAI EPDPRRS+EMKRMINA Sbjct: 98 PERISKVKKSMCRIKHVLTERAIAEPDPRRSSEMKRMINA 137 >gb|ACG35150.1| 39S ribosomal protein L47 [Zea mays] Length = 138 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 263 PERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINA 144 PERISKV+KSMCRIKHVLTERAI EPDPRRS+EMKRMINA Sbjct: 98 PERISKVKKSMCRIKHVLTERAIAEPDPRRSSEMKRMINA 137 >ref|NP_001147665.1| 39S ribosomal protein L47 [Zea mays] gi|195612940|gb|ACG28300.1| 39S ribosomal protein L47 [Zea mays] Length = 138 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 263 PERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINA 144 PERISKV+KSMCRIKHVLTERAI EPDPRRS+EMKRMINA Sbjct: 98 PERISKVKKSMCRIKHVLTERAIAEPDPRRSSEMKRMINA 137 >ref|XP_006655739.1| PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Oryza brachyantha] Length = 147 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -2 Query: 263 PERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMIN 147 PERISKV+KSMCRIKHVLTERAI EPDPRRSAEMKRMIN Sbjct: 107 PERISKVKKSMCRIKHVLTERAIAEPDPRRSAEMKRMIN 145 >ref|XP_006439758.1| hypothetical protein CICLE_v10022742mg [Citrus clementina] gi|557542020|gb|ESR52998.1| hypothetical protein CICLE_v10022742mg [Citrus clementina] Length = 143 Score = 77.4 bits (189), Expect = 2e-12 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 263 PERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINA 144 PERI KVRKSMCRIK VLTERAIEEPDPRRSAEMKRMINA Sbjct: 103 PERIPKVRKSMCRIKQVLTERAIEEPDPRRSAEMKRMINA 142 >ref|XP_006417761.1| hypothetical protein EUTSA_v10009035mg [Eutrema salsugineum] gi|557095532|gb|ESQ36114.1| hypothetical protein EUTSA_v10009035mg [Eutrema salsugineum] Length = 144 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -2 Query: 263 PERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMIN 147 PERI KVR+SMCRIKHVLTERAIEEPDPRRSAEMKRM+N Sbjct: 104 PERIPKVRRSMCRIKHVLTERAIEEPDPRRSAEMKRMVN 142 >ref|XP_004964406.1| PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Setaria italica] Length = 145 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -2 Query: 263 PERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMIN 147 PERISKV+KSMCRIKHVLTERAI EPDPRRSAEMKRMIN Sbjct: 105 PERISKVKKSMCRIKHVLTERAIAEPDPRRSAEMKRMIN 143 >ref|XP_006292012.1| hypothetical protein CARUB_v10018201mg [Capsella rubella] gi|565468266|ref|XP_006292013.1| hypothetical protein CARUB_v10018201mg [Capsella rubella] gi|482560719|gb|EOA24910.1| hypothetical protein CARUB_v10018201mg [Capsella rubella] gi|482560720|gb|EOA24911.1| hypothetical protein CARUB_v10018201mg [Capsella rubella] Length = 144 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -2 Query: 263 PERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMIN 147 PERI KVR+SMCRIKHVLTERAIEEPDPRRSAEMKRM+N Sbjct: 104 PERIPKVRRSMCRIKHVLTERAIEEPDPRRSAEMKRMVN 142 >ref|XP_002889667.1| ribosomal protein L29 family protein [Arabidopsis lyrata subsp. lyrata] gi|297335509|gb|EFH65926.1| ribosomal protein L29 family protein [Arabidopsis lyrata subsp. lyrata] Length = 143 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -2 Query: 263 PERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMIN 147 PERI KVR+SMCRIKHVLTERAIEEPDPRRSAEMKRM+N Sbjct: 103 PERIPKVRRSMCRIKHVLTERAIEEPDPRRSAEMKRMVN 141 >ref|XP_006476735.1| PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Citrus sinensis] Length = 143 Score = 77.0 bits (188), Expect = 3e-12 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 263 PERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINA 144 PER+ KVRKSMCRIK VLTERAIEEPDPRRSAEMKRMINA Sbjct: 103 PERVPKVRKSMCRIKQVLTERAIEEPDPRRSAEMKRMINA 142 >ref|XP_006345029.1| PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Solanum tuberosum] Length = 142 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 263 PERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINA 144 PERISKVRKSMCRIKHVLTERAI+E DPRRS EMKRMINA Sbjct: 102 PERISKVRKSMCRIKHVLTERAIDEADPRRSTEMKRMINA 141