BLASTX nr result
ID: Mentha27_contig00015387
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00015387 (350 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27923.1| hypothetical protein MIMGU_mgv1a000311mg [Mimulus... 79 6e-13 ref|XP_006347065.1| PREDICTED: mediator of RNA polymerase II tra... 69 9e-10 ref|XP_004232849.1| PREDICTED: mediator of RNA polymerase II tra... 69 9e-10 ref|XP_004158063.1| PREDICTED: mediator of RNA polymerase II tra... 67 2e-09 emb|CBI14793.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_006467828.1| PREDICTED: mediator of RNA polymerase II tra... 67 3e-09 ref|XP_006449306.1| hypothetical protein CICLE_v10014062mg [Citr... 67 3e-09 ref|XP_002305810.2| hypothetical protein POPTR_0004s04050g [Popu... 65 7e-09 gb|EPS69188.1| hypothetical protein M569_05578, partial [Genlise... 65 7e-09 ref|XP_002519035.1| conserved hypothetical protein [Ricinus comm... 65 7e-09 ref|XP_006377328.1| hypothetical protein POPTR_0011s04940g [Popu... 65 1e-08 ref|XP_003541539.1| PREDICTED: mediator of RNA polymerase II tra... 65 1e-08 ref|XP_007025672.1| Sensitive to freezing 6 [Theobroma cacao] gi... 65 1e-08 ref|XP_002305019.2| hypothetical protein POPTR_0004s04040g [Popu... 64 2e-08 gb|EXB82793.1| hypothetical protein L484_012106 [Morus notabilis] 64 3e-08 ref|XP_007159313.1| hypothetical protein PHAVU_002G227600g [Phas... 62 1e-07 ref|XP_007214550.1| hypothetical protein PRUPE_ppa000947mg [Prun... 62 1e-07 ref|NP_001190676.1| mediator of RNA polymerase II transcription ... 61 1e-07 ref|NP_192401.5| mediator of RNA polymerase II transcription sub... 61 1e-07 emb|CAB81034.1| hypothetical protein [Arabidopsis thaliana] 61 1e-07 >gb|EYU27923.1| hypothetical protein MIMGU_mgv1a000311mg [Mimulus guttatus] Length = 1270 Score = 79.0 bits (193), Expect = 6e-13 Identities = 39/55 (70%), Positives = 43/55 (78%) Frame = +1 Query: 184 VMMDKDSTXXXXXNSNDDLMDEDSGNPATVFHIKLKQPRSNLLHKMSVPELCRTF 348 VM +K+S DD MDEDSGNPATVF IKLKQP+SNLL+KMSVPELCRTF Sbjct: 61 VMTEKESAAAGSNIPTDDPMDEDSGNPATVFCIKLKQPKSNLLYKMSVPELCRTF 115 >ref|XP_006347065.1| PREDICTED: mediator of RNA polymerase II transcription subunit 16-like isoform X1 [Solanum tuberosum] Length = 1244 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +1 Query: 229 NDDLMDEDSGNPATVFHIKLKQPRSNLLHKMSVPELCRTF 348 +DD MDED+ NPA VF I+LKQPRSNLLHKMSVPELCR F Sbjct: 65 DDDPMDEDTVNPAVVFCIRLKQPRSNLLHKMSVPELCRNF 104 >ref|XP_004232849.1| PREDICTED: mediator of RNA polymerase II transcription subunit 16-like [Solanum lycopersicum] Length = 1246 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +1 Query: 229 NDDLMDEDSGNPATVFHIKLKQPRSNLLHKMSVPELCRTF 348 +DD MDED+ NPA VF I+LKQPRSNLLHKMSVPELCR F Sbjct: 67 DDDPMDEDTVNPAVVFCIRLKQPRSNLLHKMSVPELCRNF 106 >ref|XP_004158063.1| PREDICTED: mediator of RNA polymerase II transcription subunit 16-like, partial [Cucumis sativus] Length = 133 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = +1 Query: 232 DDLMDEDSGNPATVFHIKLKQPRSNLLHKMSVPELCRTF 348 DD MDED PATVF IKLKQPRSNL HKMSVPELCR F Sbjct: 42 DDAMDEDLVTPATVFRIKLKQPRSNLQHKMSVPELCRNF 80 >emb|CBI14793.3| unnamed protein product [Vitis vinifera] Length = 513 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = +1 Query: 232 DDLMDEDSGNPATVFHIKLKQPRSNLLHKMSVPELCRTF 348 DD M+EDS NPATVF I+LKQPRSNL HKMSVPELCR F Sbjct: 53 DDPMEEDSVNPATVFCIRLKQPRSNLQHKMSVPELCRNF 91 >ref|XP_006467828.1| PREDICTED: mediator of RNA polymerase II transcription subunit 16-like isoform X1 [Citrus sinensis] Length = 1255 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +1 Query: 229 NDDLMDEDSGNPATVFHIKLKQPRSNLLHKMSVPELCRTF 348 +DD MDEDS PATVF I+LKQPRSNL HKMSVPELCR F Sbjct: 59 SDDPMDEDSVTPATVFCIRLKQPRSNLQHKMSVPELCRNF 98 >ref|XP_006449306.1| hypothetical protein CICLE_v10014062mg [Citrus clementina] gi|557551917|gb|ESR62546.1| hypothetical protein CICLE_v10014062mg [Citrus clementina] Length = 1252 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +1 Query: 229 NDDLMDEDSGNPATVFHIKLKQPRSNLLHKMSVPELCRTF 348 +DD MDEDS PATVF I+LKQPRSNL HKMSVPELCR F Sbjct: 56 SDDPMDEDSVTPATVFCIRLKQPRSNLQHKMSVPELCRNF 95 >ref|XP_002305810.2| hypothetical protein POPTR_0004s04050g [Populus trichocarpa] gi|550340281|gb|EEE86321.2| hypothetical protein POPTR_0004s04050g [Populus trichocarpa] Length = 1328 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +1 Query: 232 DDLMDEDSGNPATVFHIKLKQPRSNLLHKMSVPELCRTF 348 DD M+EDS +PATVF I+LKQPRSNL HKMSVPELCR F Sbjct: 50 DDSMEEDSVSPATVFCIRLKQPRSNLQHKMSVPELCRKF 88 >gb|EPS69188.1| hypothetical protein M569_05578, partial [Genlisea aurea] Length = 1041 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = +1 Query: 223 NSNDDLMDEDSGNPATVFHIKLKQPRSNLLHKMSVPELCRTF 348 N DD M+EDS N +TVF I LKQP+SNLLHKM VPELCRTF Sbjct: 1 NPTDDPMEEDSVNSSTVFCISLKQPKSNLLHKMRVPELCRTF 42 >ref|XP_002519035.1| conserved hypothetical protein [Ricinus communis] gi|223541698|gb|EEF43246.1| conserved hypothetical protein [Ricinus communis] Length = 1255 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +1 Query: 232 DDLMDEDSGNPATVFHIKLKQPRSNLLHKMSVPELCRTF 348 DD M+EDS +PATVF I+LKQPRSNL HKMSVPELCR F Sbjct: 59 DDPMEEDSVSPATVFCIRLKQPRSNLQHKMSVPELCRNF 97 >ref|XP_006377328.1| hypothetical protein POPTR_0011s04940g [Populus trichocarpa] gi|550327616|gb|ERP55125.1| hypothetical protein POPTR_0011s04940g [Populus trichocarpa] Length = 1249 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +1 Query: 232 DDLMDEDSGNPATVFHIKLKQPRSNLLHKMSVPELCRTF 348 DD M+EDS +PATVF I+LKQPRSNL HKMSVPELCR F Sbjct: 56 DDPMEEDSVSPATVFCIRLKQPRSNLQHKMSVPELCRQF 94 >ref|XP_003541539.1| PREDICTED: mediator of RNA polymerase II transcription subunit 16-like isoform X1 [Glycine max] gi|571498821|ref|XP_006594323.1| PREDICTED: mediator of RNA polymerase II transcription subunit 16-like isoform X2 [Glycine max] Length = 1244 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 241 MDEDSGNPATVFHIKLKQPRSNLLHKMSVPELCRTF 348 M+ED NPATVF I+LKQPRSNLLHKMSVPELCR F Sbjct: 63 MEEDPVNPATVFSIRLKQPRSNLLHKMSVPELCRNF 98 >ref|XP_007025672.1| Sensitive to freezing 6 [Theobroma cacao] gi|508781038|gb|EOY28294.1| Sensitive to freezing 6 [Theobroma cacao] Length = 1249 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/51 (60%), Positives = 36/51 (70%) Frame = +1 Query: 196 KDSTXXXXXNSNDDLMDEDSGNPATVFHIKLKQPRSNLLHKMSVPELCRTF 348 +D + D M++DS NPATVF I+LKQPRSNL HKMSVPELCR F Sbjct: 45 EDEVVTSSEKTEDTPMEDDSVNPATVFCIRLKQPRSNLQHKMSVPELCRNF 95 >ref|XP_002305019.2| hypothetical protein POPTR_0004s04040g [Populus trichocarpa] gi|550340280|gb|EEE85530.2| hypothetical protein POPTR_0004s04040g [Populus trichocarpa] Length = 1236 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +1 Query: 232 DDLMDEDSGNPATVFHIKLKQPRSNLLHKMSVPELCRTF 348 DD M+EDS +PATVF I+LKQPRSNL HKMSVPELCR + Sbjct: 50 DDSMEEDSVSPATVFCIRLKQPRSNLQHKMSVPELCRKY 88 >gb|EXB82793.1| hypothetical protein L484_012106 [Morus notabilis] Length = 1003 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +1 Query: 235 DLMDEDSGNPATVFHIKLKQPRSNLLHKMSVPELCRTF 348 D M+EDS +PA VF I+LKQPRSNLLHKMSVPELCR F Sbjct: 41 DPMEEDSVSPAAVFCIRLKQPRSNLLHKMSVPELCRNF 78 >ref|XP_007159313.1| hypothetical protein PHAVU_002G227600g [Phaseolus vulgaris] gi|561032728|gb|ESW31307.1| hypothetical protein PHAVU_002G227600g [Phaseolus vulgaris] Length = 1241 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +1 Query: 241 MDEDSGNPATVFHIKLKQPRSNLLHKMSVPELCRTF 348 M+ED NPATVF I+LKQ RSNLLHKMSVPELCR F Sbjct: 57 MEEDLVNPATVFSIRLKQSRSNLLHKMSVPELCRNF 92 >ref|XP_007214550.1| hypothetical protein PRUPE_ppa000947mg [Prunus persica] gi|462410415|gb|EMJ15749.1| hypothetical protein PRUPE_ppa000947mg [Prunus persica] Length = 953 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +1 Query: 223 NSNDDLMDEDSGNPATVFHIKLKQPRSNLLHKMSVPELCRTF 348 + + D M+EDS +PA VF I+LKQPRSNL HKMSVPELCR F Sbjct: 44 DKSGDPMEEDSVSPAAVFCIRLKQPRSNLQHKMSVPELCRNF 85 >ref|NP_001190676.1| mediator of RNA polymerase II transcription subunit 16 [Arabidopsis thaliana] gi|332657042|gb|AEE82442.1| mediator of RNA polymerase II transcription subunit 16 [Arabidopsis thaliana] Length = 1267 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = +1 Query: 223 NSNDDLMDEDSGNPATVFHIKLKQPRSNLLHKMSVPELCRTF 348 NS+ M+ D +PATVF +KLKQP SNLLHKMSVPELCR F Sbjct: 71 NSSSSNMEIDPVSPATVFCVKLKQPNSNLLHKMSVPELCRNF 112 >ref|NP_192401.5| mediator of RNA polymerase II transcription subunit 16 [Arabidopsis thaliana] gi|395406812|sp|F4JGZ1.1|MED16_ARATH RecName: Full=Mediator of RNA polymerase II transcription subunit 16; AltName: Full=Protein SENSITIVE TO FREEZING 6 gi|332657041|gb|AEE82441.1| mediator of RNA polymerase II transcription subunit 16 [Arabidopsis thaliana] Length = 1278 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = +1 Query: 223 NSNDDLMDEDSGNPATVFHIKLKQPRSNLLHKMSVPELCRTF 348 NS+ M+ D +PATVF +KLKQP SNLLHKMSVPELCR F Sbjct: 71 NSSSSNMEIDPVSPATVFCVKLKQPNSNLLHKMSVPELCRNF 112 >emb|CAB81034.1| hypothetical protein [Arabidopsis thaliana] Length = 1196 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = +1 Query: 223 NSNDDLMDEDSGNPATVFHIKLKQPRSNLLHKMSVPELCRTF 348 NS+ M+ D +PATVF +KLKQP SNLLHKMSVPELCR F Sbjct: 71 NSSSSNMEIDPVSPATVFCVKLKQPNSNLLHKMSVPELCRNF 112