BLASTX nr result
ID: Mentha27_contig00015309
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00015309 (323 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABX90014.1| SOC1-like protein 1 [Sinningia speciosa] 57 2e-06 >gb|ABX90014.1| SOC1-like protein 1 [Sinningia speciosa] Length = 212 Score = 57.4 bits (137), Expect = 2e-06 Identities = 34/57 (59%), Positives = 42/57 (73%) Frame = -3 Query: 321 EKFLIEENQSLREKIGLKQKHVRDEVHREIGSYSRSRLSSEAAVTTELFIGLPTTRN 151 EKFL+EEN LREK ++ ++ ++ HREIGS S+S LSSE V TELFIG P TRN Sbjct: 157 EKFLLEENARLREKSEMRLRNGAEK-HREIGSCSQSSLSSE--VMTELFIGPPITRN 210