BLASTX nr result
ID: Mentha27_contig00015087
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00015087 (443 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006844392.1| hypothetical protein AMTR_s00142p00090080 [A... 62 8e-08 ref|XP_002316482.1| SNF7 family protein [Populus trichocarpa] gi... 62 8e-08 gb|EPS74302.1| charged multivesicular body protein 5, partial [G... 62 1e-07 ref|XP_006653935.1| PREDICTED: charged multivesicular body prote... 61 2e-07 ref|XP_007010475.1| SNF7 family protein [Theobroma cacao] gi|508... 60 2e-07 gb|EXB39587.1| Charged multivesicular body protein 5 [Morus nota... 60 3e-07 ref|XP_006854644.1| hypothetical protein AMTR_s00030p00194030 [A... 60 3e-07 ref|XP_004960940.1| PREDICTED: charged multivesicular body prote... 60 4e-07 ref|XP_004960939.1| PREDICTED: charged multivesicular body prote... 60 4e-07 gb|AFW75094.1| putative SNF domain containing family protein [Ze... 60 4e-07 ref|XP_002439091.1| hypothetical protein SORBIDRAFT_09g000340 [S... 60 4e-07 ref|XP_002518614.1| Charged multivesicular body protein, putativ... 60 4e-07 gb|ABR17167.1| unknown [Picea sitchensis] 60 4e-07 ref|NP_001151295.1| LOC100284928 [Zea mays] gi|195645612|gb|ACG4... 60 4e-07 gb|ACG32800.1| charged multivesicular body protein 5 [Zea mays] 60 4e-07 gb|EYU19845.1| hypothetical protein MIMGU_mgv1a012965mg [Mimulus... 59 5e-07 ref|XP_006345880.1| PREDICTED: charged multivesicular body prote... 59 5e-07 ref|XP_004307072.1| PREDICTED: charged multivesicular body prote... 59 5e-07 ref|XP_004239736.1| PREDICTED: charged multivesicular body prote... 59 5e-07 gb|AFK38216.1| unknown [Lotus japonicus] 59 5e-07 >ref|XP_006844392.1| hypothetical protein AMTR_s00142p00090080 [Amborella trichopoda] gi|548846838|gb|ERN06067.1| hypothetical protein AMTR_s00142p00090080 [Amborella trichopoda] Length = 235 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 98 QINKRGDSVDEKIKKLDAELVRYKEQIKKTRP 3 +INKRGD+VDEKIKKLDAEL RYKEQIKKTRP Sbjct: 23 RINKRGDTVDEKIKKLDAELTRYKEQIKKTRP 54 >ref|XP_002316482.1| SNF7 family protein [Populus trichocarpa] gi|222865522|gb|EEF02653.1| SNF7 family protein [Populus trichocarpa] Length = 236 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 98 QINKRGDSVDEKIKKLDAELVRYKEQIKKTRP 3 +INKRGD+VDEKIKKLDAEL RYKEQIKKTRP Sbjct: 23 KINKRGDTVDEKIKKLDAELARYKEQIKKTRP 54 >gb|EPS74302.1| charged multivesicular body protein 5, partial [Genlisea aurea] Length = 209 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 98 QINKRGDSVDEKIKKLDAELVRYKEQIKKTRP 3 QINKRG+SVDEKI+KLDAEL RYKEQIKKTRP Sbjct: 1 QINKRGESVDEKIQKLDAELARYKEQIKKTRP 32 >ref|XP_006653935.1| PREDICTED: charged multivesicular body protein 5-like [Oryza brachyantha] Length = 232 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 98 QINKRGDSVDEKIKKLDAELVRYKEQIKKTRP 3 +I KRGDSVDEKIKKLDAEL RYKEQIKKTRP Sbjct: 23 RIGKRGDSVDEKIKKLDAELARYKEQIKKTRP 54 >ref|XP_007010475.1| SNF7 family protein [Theobroma cacao] gi|508727388|gb|EOY19285.1| SNF7 family protein [Theobroma cacao] Length = 236 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 98 QINKRGDSVDEKIKKLDAELVRYKEQIKKTRP 3 +INKRGD+VDEK+KKLDAEL RYKEQIKKTRP Sbjct: 23 RINKRGDTVDEKLKKLDAELSRYKEQIKKTRP 54 >gb|EXB39587.1| Charged multivesicular body protein 5 [Morus notabilis] Length = 234 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 98 QINKRGDSVDEKIKKLDAELVRYKEQIKKTRP 3 +INKRGDSV+EKIKKLD EL RYKEQIKKTRP Sbjct: 23 RINKRGDSVEEKIKKLDVELTRYKEQIKKTRP 54 >ref|XP_006854644.1| hypothetical protein AMTR_s00030p00194030 [Amborella trichopoda] gi|548858330|gb|ERN16111.1| hypothetical protein AMTR_s00030p00194030 [Amborella trichopoda] Length = 254 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 98 QINKRGDSVDEKIKKLDAELVRYKEQIKKTRP 3 +INKRGD+VDEK+KKLDAEL RYKEQIKKTRP Sbjct: 23 RINKRGDTVDEKLKKLDAELNRYKEQIKKTRP 54 >ref|XP_004960940.1| PREDICTED: charged multivesicular body protein 5-like isoform X2 [Setaria italica] Length = 228 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 98 QINKRGDSVDEKIKKLDAELVRYKEQIKKTRP 3 +I KRGD+VDEKIKKLDAEL RYKEQIKKTRP Sbjct: 23 RITKRGDTVDEKIKKLDAELARYKEQIKKTRP 54 >ref|XP_004960939.1| PREDICTED: charged multivesicular body protein 5-like isoform X1 [Setaria italica] Length = 249 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 98 QINKRGDSVDEKIKKLDAELVRYKEQIKKTRP 3 +I KRGD+VDEKIKKLDAEL RYKEQIKKTRP Sbjct: 23 RITKRGDTVDEKIKKLDAELARYKEQIKKTRP 54 >gb|AFW75094.1| putative SNF domain containing family protein [Zea mays] Length = 217 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 98 QINKRGDSVDEKIKKLDAELVRYKEQIKKTRP 3 +I KRGD+VDEKIKKLDAEL RYKEQIKKTRP Sbjct: 23 RITKRGDTVDEKIKKLDAELARYKEQIKKTRP 54 >ref|XP_002439091.1| hypothetical protein SORBIDRAFT_09g000340 [Sorghum bicolor] gi|241944376|gb|EES17521.1| hypothetical protein SORBIDRAFT_09g000340 [Sorghum bicolor] Length = 228 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 98 QINKRGDSVDEKIKKLDAELVRYKEQIKKTRP 3 +I KRGD+VDEKIKKLDAEL RYKEQIKKTRP Sbjct: 23 RITKRGDTVDEKIKKLDAELARYKEQIKKTRP 54 >ref|XP_002518614.1| Charged multivesicular body protein, putative [Ricinus communis] gi|223542213|gb|EEF43756.1| Charged multivesicular body protein, putative [Ricinus communis] Length = 237 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 98 QINKRGDSVDEKIKKLDAELVRYKEQIKKTRP 3 +INK+GDSVD+KIKKLDAEL RY+EQIKKTRP Sbjct: 23 RINKKGDSVDDKIKKLDAELTRYREQIKKTRP 54 >gb|ABR17167.1| unknown [Picea sitchensis] Length = 235 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 98 QINKRGDSVDEKIKKLDAELVRYKEQIKKTRP 3 +INKRGD+VDEK+KKLD EL RYKEQIKKTRP Sbjct: 23 RINKRGDTVDEKVKKLDIELARYKEQIKKTRP 54 >ref|NP_001151295.1| LOC100284928 [Zea mays] gi|195645612|gb|ACG42274.1| charged multivesicular body protein 5 [Zea mays] gi|195652359|gb|ACG45647.1| charged multivesicular body protein 5 [Zea mays] gi|413942446|gb|AFW75095.1| putative SNF domain containing family protein [Zea mays] Length = 228 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 98 QINKRGDSVDEKIKKLDAELVRYKEQIKKTRP 3 +I KRGD+VDEKIKKLDAEL RYKEQIKKTRP Sbjct: 23 RITKRGDTVDEKIKKLDAELARYKEQIKKTRP 54 >gb|ACG32800.1| charged multivesicular body protein 5 [Zea mays] Length = 228 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 98 QINKRGDSVDEKIKKLDAELVRYKEQIKKTRP 3 +I KRGD+VDEKIKKLDAEL RYKEQIKKTRP Sbjct: 23 RITKRGDTVDEKIKKLDAELARYKEQIKKTRP 54 >gb|EYU19845.1| hypothetical protein MIMGU_mgv1a012965mg [Mimulus guttatus] Length = 234 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 98 QINKRGDSVDEKIKKLDAELVRYKEQIKKTRP 3 +INKRG+SVD+KIK+LDAEL RYKEQIKKTRP Sbjct: 23 RINKRGESVDDKIKRLDAELARYKEQIKKTRP 54 >ref|XP_006345880.1| PREDICTED: charged multivesicular body protein 5-like [Solanum tuberosum] Length = 233 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 98 QINKRGDSVDEKIKKLDAELVRYKEQIKKTRP 3 +INKRG+SV+EKIKKLDAEL RYKEQ+KKTRP Sbjct: 23 RINKRGESVEEKIKKLDAELARYKEQLKKTRP 54 >ref|XP_004307072.1| PREDICTED: charged multivesicular body protein 5-like [Fragaria vesca subsp. vesca] Length = 237 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 98 QINKRGDSVDEKIKKLDAELVRYKEQIKKTRP 3 +INKRGD+VDEKIKKLD EL RYKEQIKKTRP Sbjct: 23 RINKRGDTVDEKIKKLDVELNRYKEQIKKTRP 54 >ref|XP_004239736.1| PREDICTED: charged multivesicular body protein 5-like [Solanum lycopersicum] Length = 234 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 98 QINKRGDSVDEKIKKLDAELVRYKEQIKKTRP 3 +INKRG+SV+EKIKKLDAEL RYKEQ+KKTRP Sbjct: 23 RINKRGESVEEKIKKLDAELARYKEQLKKTRP 54 >gb|AFK38216.1| unknown [Lotus japonicus] Length = 237 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 98 QINKRGDSVDEKIKKLDAELVRYKEQIKKTRP 3 +I KRGDSV+EKIKKLDAEL RYKEQIKKTRP Sbjct: 23 RITKRGDSVEEKIKKLDAELTRYKEQIKKTRP 54