BLASTX nr result
ID: Mentha27_contig00015059
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00015059 (460 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41105.1| hypothetical protein MIMGU_mgv1a006576mg [Mimulus... 57 3e-06 >gb|EYU41105.1| hypothetical protein MIMGU_mgv1a006576mg [Mimulus guttatus] Length = 438 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 2/37 (5%) Frame = +1 Query: 319 MDKDKSHH--GNILPPSGRYSVFSPPGNSYTAKPEQT 423 M+KDKSHH G+ LPPSGRYS FSPP +SY KPEQ+ Sbjct: 1 MEKDKSHHCSGSSLPPSGRYSGFSPPNSSYNVKPEQS 37