BLASTX nr result
ID: Mentha27_contig00013865
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00013865 (1823 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN82611.1| hypothetical protein VITISV_042938 [Vitis vinifera] 64 3e-07 gb|EYU37577.1| hypothetical protein MIMGU_mgv1a011708mg [Mimulus... 62 9e-07 gb|EXB75587.1| hypothetical protein L484_026061 [Morus notabilis] 60 3e-06 >emb|CAN82611.1| hypothetical protein VITISV_042938 [Vitis vinifera] Length = 296 Score = 63.5 bits (153), Expect = 3e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 1520 VIAVCVSLGGLFFLAFIAVGLFCFVKKKKKPIMV 1419 +IAVCVSLGGLFFLAF+A GLFC KKKKKP+MV Sbjct: 198 IIAVCVSLGGLFFLAFLAAGLFCLAKKKKKPVMV 231 >gb|EYU37577.1| hypothetical protein MIMGU_mgv1a011708mg [Mimulus guttatus] Length = 273 Score = 62.0 bits (149), Expect = 9e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 1520 VIAVCVSLGGLFFLAFIAVGLFCFVKKKKKPIM 1422 +IAVCVSLGG FFLAF+AVGLFC KKKKKPIM Sbjct: 219 IIAVCVSLGGAFFLAFLAVGLFCLAKKKKKPIM 251 >gb|EXB75587.1| hypothetical protein L484_026061 [Morus notabilis] Length = 523 Score = 60.5 bits (145), Expect = 3e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 1520 VIAVCVSLGGLFFLAFIAVGLFCFVKKKKKPIMV 1419 VIAVCVS+GG FFLAF+ VGLFC KKKKKP+MV Sbjct: 420 VIAVCVSVGGAFFLAFLLVGLFCLAKKKKKPVMV 453