BLASTX nr result
ID: Mentha27_contig00013455
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00013455 (567 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19377.1| hypothetical protein MIMGU_mgv1a0175922mg [Mimulu... 108 7e-22 ref|XP_007206183.1| hypothetical protein PRUPE_ppa013857mg [Prun... 107 3e-21 ref|XP_006408015.1| hypothetical protein EUTSA_v10021802mg [Eutr... 105 6e-21 ref|XP_007207409.1| hypothetical protein PRUPE_ppa014548mg [Prun... 104 2e-20 gb|ADK27677.1| plasma membrane protein 3-2 [Salvia miltiorrhiza] 104 2e-20 ref|XP_003626135.1| Hydrophobic protein LTI6B [Medicago truncatu... 103 2e-20 gb|ABD33207.2| Protein of unknown function UPF0057 [Medicago tru... 103 2e-20 ref|XP_006428346.1| hypothetical protein CICLE_v10013304mg [Citr... 103 4e-20 ref|XP_004302327.1| PREDICTED: hydrophobic protein RCI2A-like [F... 103 4e-20 gb|AAF26091.1|AC012393_17 low temperature and salt responsive pr... 102 7e-20 ref|XP_003626131.1| Hydrophobic protein RCI2B [Medicago truncatu... 102 7e-20 ref|XP_004494505.1| PREDICTED: hydrophobic protein LTI6B-like [C... 102 9e-20 ref|XP_006408016.1| hypothetical protein EUTSA_v10021895mg [Eutr... 101 1e-19 ref|XP_003626132.1| Hydrophobic protein LTI6A [Medicago truncatu... 101 1e-19 gb|AFC41201.1| PM-YC3.6-Lti6b [Binary expression vector PM-YC3.6... 101 1e-19 gb|AHL20265.1| stress-induced protein [Olea europaea] 101 2e-19 ref|NP_187240.1| Hydrophobic protein RCI2B [Arabidopsis thaliana... 101 2e-19 ref|XP_006298933.1| hypothetical protein CARUB_v10015055mg [Caps... 101 2e-19 gb|AFK38849.1| unknown [Lotus japonicus] gi|388522485|gb|AFK4930... 101 2e-19 ref|XP_002884539.1| low temperature and salt responsive protein ... 101 2e-19 >gb|EYU19377.1| hypothetical protein MIMGU_mgv1a0175922mg [Mimulus guttatus] Length = 54 Score = 108 bits (271), Expect = 7e-22 Identities = 50/54 (92%), Positives = 54/54 (100%) Frame = -3 Query: 502 MGTATFVDIIVAILLPPLGVFLKFGCQVEFWICLLLTLFGYLPGIIYAVYAITK 341 MG+ATFVDIIVAILLPPLGVFLKFGC+VEFWICL+LTLFGYLPGIIYA+YAITK Sbjct: 1 MGSATFVDIIVAILLPPLGVFLKFGCEVEFWICLVLTLFGYLPGIIYAIYAITK 54 >ref|XP_007206183.1| hypothetical protein PRUPE_ppa013857mg [Prunus persica] gi|462401825|gb|EMJ07382.1| hypothetical protein PRUPE_ppa013857mg [Prunus persica] Length = 93 Score = 107 bits (266), Expect = 3e-21 Identities = 47/55 (85%), Positives = 53/55 (96%) Frame = -3 Query: 505 KMGTATFVDIIVAILLPPLGVFLKFGCQVEFWICLLLTLFGYLPGIIYAVYAITK 341 +MGTATFVDII+AILLPPLGVFLKFGC+ EFWICL+LTLFGYLPGIIYA+Y +TK Sbjct: 39 RMGTATFVDIIIAILLPPLGVFLKFGCEAEFWICLILTLFGYLPGIIYAIYILTK 93 >ref|XP_006408015.1| hypothetical protein EUTSA_v10021802mg [Eutrema salsugineum] gi|557109161|gb|ESQ49468.1| hypothetical protein EUTSA_v10021802mg [Eutrema salsugineum] Length = 111 Score = 105 bits (263), Expect = 6e-21 Identities = 47/56 (83%), Positives = 55/56 (98%) Frame = -3 Query: 505 KMGTATFVDIIVAILLPPLGVFLKFGCQVEFWICLLLTLFGYLPGIIYAVYAITKD 338 KMGTATFV+II+AI+LPPLGVFLKFGC++EFWICL+LTL GYLPGIIYA+YAITK+ Sbjct: 56 KMGTATFVEIILAIILPPLGVFLKFGCKIEFWICLILTLLGYLPGIIYALYAITKN 111 >ref|XP_007207409.1| hypothetical protein PRUPE_ppa014548mg [Prunus persica] gi|462403051|gb|EMJ08608.1| hypothetical protein PRUPE_ppa014548mg [Prunus persica] Length = 57 Score = 104 bits (259), Expect = 2e-20 Identities = 46/53 (86%), Positives = 51/53 (96%) Frame = -3 Query: 499 GTATFVDIIVAILLPPLGVFLKFGCQVEFWICLLLTLFGYLPGIIYAVYAITK 341 GTA F+DI++AILLPPLGVFLKFGC VEFWICLLLT+FGY+PGIIYAVYAITK Sbjct: 5 GTANFIDILIAILLPPLGVFLKFGCHVEFWICLLLTIFGYIPGIIYAVYAITK 57 >gb|ADK27677.1| plasma membrane protein 3-2 [Salvia miltiorrhiza] Length = 54 Score = 104 bits (259), Expect = 2e-20 Identities = 46/54 (85%), Positives = 51/54 (94%) Frame = -3 Query: 502 MGTATFVDIIVAILLPPLGVFLKFGCQVEFWICLLLTLFGYLPGIIYAVYAITK 341 MGTATF+DII+AILLPPLGVFLKFGC EFWICL+LTLFGY+PGIIYA+Y ITK Sbjct: 1 MGTATFIDIIIAILLPPLGVFLKFGCGAEFWICLILTLFGYIPGIIYAIYIITK 54 >ref|XP_003626135.1| Hydrophobic protein LTI6B [Medicago truncatula] gi|355501150|gb|AES82353.1| Hydrophobic protein LTI6B [Medicago truncatula] Length = 83 Score = 103 bits (258), Expect = 2e-20 Identities = 46/54 (85%), Positives = 52/54 (96%) Frame = -3 Query: 502 MGTATFVDIIVAILLPPLGVFLKFGCQVEFWICLLLTLFGYLPGIIYAVYAITK 341 MGTAT +DIIVAI+LPPLGVFLKFGC VEFW+CL+LTLFGYLPGI+YA+YAITK Sbjct: 1 MGTATCIDIIVAIILPPLGVFLKFGCHVEFWLCLVLTLFGYLPGILYAIYAITK 54 >gb|ABD33207.2| Protein of unknown function UPF0057 [Medicago truncatula] Length = 54 Score = 103 bits (258), Expect = 2e-20 Identities = 46/54 (85%), Positives = 52/54 (96%) Frame = -3 Query: 502 MGTATFVDIIVAILLPPLGVFLKFGCQVEFWICLLLTLFGYLPGIIYAVYAITK 341 MGTAT +DIIVAI+LPPLGVFLKFGC VEFW+CL+LTLFGYLPGI+YA+YAITK Sbjct: 1 MGTATCIDIIVAIILPPLGVFLKFGCHVEFWLCLVLTLFGYLPGILYAIYAITK 54 >ref|XP_006428346.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|567871515|ref|XP_006428347.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|568853386|ref|XP_006480340.1| PREDICTED: hydrophobic protein LTI6A-like [Citrus sinensis] gi|557530403|gb|ESR41586.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|557530404|gb|ESR41587.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] Length = 58 Score = 103 bits (256), Expect = 4e-20 Identities = 46/54 (85%), Positives = 53/54 (98%) Frame = -3 Query: 499 GTATFVDIIVAILLPPLGVFLKFGCQVEFWICLLLTLFGYLPGIIYAVYAITKD 338 GTAT +DII+AI+LPPLGVFLKFGC+VEFWICLLLT+FGY+PGIIYAVYAITK+ Sbjct: 5 GTATCIDIILAIILPPLGVFLKFGCKVEFWICLLLTIFGYIPGIIYAVYAITKN 58 >ref|XP_004302327.1| PREDICTED: hydrophobic protein RCI2A-like [Fragaria vesca subsp. vesca] Length = 57 Score = 103 bits (256), Expect = 4e-20 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = -3 Query: 499 GTATFVDIIVAILLPPLGVFLKFGCQVEFWICLLLTLFGYLPGIIYAVYAITK 341 GTA F+DII+AILLPPLGVFLKFGC VEFWICLLLT+FGY+PGIIYA+Y ITK Sbjct: 5 GTANFIDIIIAILLPPLGVFLKFGCHVEFWICLLLTIFGYIPGIIYAIYVITK 57 >gb|AAF26091.1|AC012393_17 low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] Length = 67 Score = 102 bits (254), Expect = 7e-20 Identities = 47/59 (79%), Positives = 54/59 (91%) Frame = -3 Query: 502 MGTATFVDIIVAILLPPLGVFLKFGCQVEFWICLLLTLFGYLPGIIYAVYAITKD*SFF 326 M TATFV+II+AI+LPPLGVFLKFGC+VEFWICL+LTLFGYLPGI+YA+Y ITK S F Sbjct: 1 MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITKKNSCF 59 >ref|XP_003626131.1| Hydrophobic protein RCI2B [Medicago truncatula] gi|87241331|gb|ABD33189.1| Protein of unknown function UPF0057; Bacterial extracellular solute-binding protein, family 3 [Medicago truncatula] gi|355501146|gb|AES82349.1| Hydrophobic protein RCI2B [Medicago truncatula] Length = 54 Score = 102 bits (254), Expect = 7e-20 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = -3 Query: 502 MGTATFVDIIVAILLPPLGVFLKFGCQVEFWICLLLTLFGYLPGIIYAVYAITK 341 MGTATFVDII++ILLPPLGVFLKFG +VEFWICL+LTLFGYLPGIIYA+Y ITK Sbjct: 1 MGTATFVDIILSILLPPLGVFLKFGLEVEFWICLVLTLFGYLPGIIYAIYIITK 54 >ref|XP_004494505.1| PREDICTED: hydrophobic protein LTI6B-like [Cicer arietinum] Length = 54 Score = 102 bits (253), Expect = 9e-20 Identities = 46/54 (85%), Positives = 51/54 (94%) Frame = -3 Query: 502 MGTATFVDIIVAILLPPLGVFLKFGCQVEFWICLLLTLFGYLPGIIYAVYAITK 341 MGTAT VDII+AI+LPPLGVFLKFGC VEFWICL+LT+ GYLPGIIYA+YAITK Sbjct: 1 MGTATCVDIILAIILPPLGVFLKFGCNVEFWICLILTILGYLPGIIYAIYAITK 54 >ref|XP_006408016.1| hypothetical protein EUTSA_v10021895mg [Eutrema salsugineum] gi|557109162|gb|ESQ49469.1| hypothetical protein EUTSA_v10021895mg [Eutrema salsugineum] Length = 54 Score = 101 bits (252), Expect = 1e-19 Identities = 44/54 (81%), Positives = 52/54 (96%) Frame = -3 Query: 502 MGTATFVDIIVAILLPPLGVFLKFGCQVEFWICLLLTLFGYLPGIIYAVYAITK 341 MGTATF+DI++AILLPPLGVFL+FGC VEFWICL+LTLFGYLPGI+YA+Y +TK Sbjct: 1 MGTATFIDILLAILLPPLGVFLRFGCGVEFWICLVLTLFGYLPGILYALYVLTK 54 >ref|XP_003626132.1| Hydrophobic protein LTI6A [Medicago truncatula] gi|87241339|gb|ABD33197.1| Protein of unknown function UPF0057 [Medicago truncatula] gi|355501147|gb|AES82350.1| Hydrophobic protein LTI6A [Medicago truncatula] gi|388497498|gb|AFK36815.1| unknown [Medicago truncatula] Length = 54 Score = 101 bits (252), Expect = 1e-19 Identities = 45/54 (83%), Positives = 51/54 (94%) Frame = -3 Query: 502 MGTATFVDIIVAILLPPLGVFLKFGCQVEFWICLLLTLFGYLPGIIYAVYAITK 341 MGTAT +DII+AI+LPPLGVFLKFGC VEFWICL+LT+ GYLPGIIYA+YAITK Sbjct: 1 MGTATCIDIILAIILPPLGVFLKFGCNVEFWICLILTILGYLPGIIYAIYAITK 54 >gb|AFC41201.1| PM-YC3.6-Lti6b [Binary expression vector PM-YC3.6-LTI6b] Length = 726 Score = 101 bits (252), Expect = 1e-19 Identities = 46/59 (77%), Positives = 54/59 (91%) Frame = -3 Query: 517 REK*KMGTATFVDIIVAILLPPLGVFLKFGCQVEFWICLLLTLFGYLPGIIYAVYAITK 341 R+ M TATFV+II+AI+LPPLGVFLKFGC+VEFWICL+LTLFGYLPGI+YA+Y ITK Sbjct: 668 RQAAAMSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 726 >gb|AHL20265.1| stress-induced protein [Olea europaea] Length = 58 Score = 101 bits (251), Expect = 2e-19 Identities = 46/54 (85%), Positives = 52/54 (96%) Frame = -3 Query: 499 GTATFVDIIVAILLPPLGVFLKFGCQVEFWICLLLTLFGYLPGIIYAVYAITKD 338 GTAT +DIIVAILLPPLGVFL++GC+VEFWICLLLT+ GYLPGIIYAVYAITK+ Sbjct: 5 GTATCIDIIVAILLPPLGVFLRYGCKVEFWICLLLTILGYLPGIIYAVYAITKN 58 >ref|NP_187240.1| Hydrophobic protein RCI2B [Arabidopsis thaliana] gi|15214252|sp|Q9ZNS6.1|RCI2B_ARATH RecName: Full=Hydrophobic protein RCI2B; AltName: Full=Low temperature and salt-responsive protein LTI6B gi|6671968|gb|AAF23227.1|AC013454_14 low temperature and salt responsive protein (LTI6B) [Arabidopsis thaliana] gi|13957673|gb|AAK50618.1|AF264749_1 hydrophobic protein RCI2B [Arabidopsis thaliana] gi|4039152|gb|AAC97511.1| low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] gi|4325219|gb|AAD17303.1| hydrophobic protein [Arabidopsis thaliana] gi|21536934|gb|AAM61275.1| hydrophobic protein RCI2B (Low temperature and salt responsive protein LTI6B) [Arabidopsis thaliana] gi|51970648|dbj|BAD44016.1| low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] gi|109134195|gb|ABG25095.1| At3g05890 [Arabidopsis thaliana] gi|110737346|dbj|BAF00618.1| low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] gi|332640791|gb|AEE74312.1| Hydrophobic protein RCI2B [Arabidopsis thaliana] Length = 54 Score = 101 bits (251), Expect = 2e-19 Identities = 45/54 (83%), Positives = 52/54 (96%) Frame = -3 Query: 502 MGTATFVDIIVAILLPPLGVFLKFGCQVEFWICLLLTLFGYLPGIIYAVYAITK 341 M TATFV+II+AI+LPPLGVFLKFGC+VEFWICL+LTLFGYLPGI+YA+Y ITK Sbjct: 1 MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >ref|XP_006298933.1| hypothetical protein CARUB_v10015055mg [Capsella rubella] gi|482567642|gb|EOA31831.1| hypothetical protein CARUB_v10015055mg [Capsella rubella] Length = 54 Score = 101 bits (251), Expect = 2e-19 Identities = 45/54 (83%), Positives = 52/54 (96%) Frame = -3 Query: 502 MGTATFVDIIVAILLPPLGVFLKFGCQVEFWICLLLTLFGYLPGIIYAVYAITK 341 M TATFV+I++AILLPPLGVFLKFGC+VEFWICL+LTLFGYLPGI+YA+Y ITK Sbjct: 1 MSTATFVEILLAILLPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >gb|AFK38849.1| unknown [Lotus japonicus] gi|388522485|gb|AFK49304.1| unknown [Lotus japonicus] Length = 54 Score = 101 bits (251), Expect = 2e-19 Identities = 45/54 (83%), Positives = 52/54 (96%) Frame = -3 Query: 502 MGTATFVDIIVAILLPPLGVFLKFGCQVEFWICLLLTLFGYLPGIIYAVYAITK 341 MGTAT VDII+AI+LPPLGVFL+FGC+VEFWICLLLT+ GY+PGIIYA+YAITK Sbjct: 1 MGTATCVDIILAIILPPLGVFLRFGCKVEFWICLLLTILGYIPGIIYAIYAITK 54 >ref|XP_002884539.1| low temperature and salt responsive protein LTI6B [Arabidopsis lyrata subsp. lyrata] gi|297330379|gb|EFH60798.1| low temperature and salt responsive protein LTI6B [Arabidopsis lyrata subsp. lyrata] Length = 67 Score = 101 bits (251), Expect = 2e-19 Identities = 45/54 (83%), Positives = 52/54 (96%) Frame = -3 Query: 502 MGTATFVDIIVAILLPPLGVFLKFGCQVEFWICLLLTLFGYLPGIIYAVYAITK 341 M TATFV+II+AI+LPPLGVFLKFGC+VEFWICL+LTLFGYLPGI+YA+Y ITK Sbjct: 1 MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54