BLASTX nr result
ID: Mentha27_contig00013373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00013373 (245 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006437259.1| hypothetical protein CICLE_v10032349mg [Citr... 77 2e-12 ref|XP_006288397.1| hypothetical protein CARUB_v10001654mg [Caps... 74 2e-11 ref|XP_003520929.1| PREDICTED: NADH--cytochrome b5 reductase 1 [... 74 2e-11 ref|XP_004144304.1| PREDICTED: NADH--cytochrome b5 reductase 1-l... 74 3e-11 gb|EPS72506.1| hypothetical protein M569_02252, partial [Genlise... 73 5e-11 ref|XP_003564467.1| PREDICTED: NADH-cytochrome b5 reductase 1-li... 73 5e-11 ref|XP_002527570.1| NADH-cytochrome B5 reductase, putative [Rici... 72 6e-11 ref|XP_007015531.1| NADH:cytochrome B5 reductase 1 [Theobroma ca... 72 8e-11 ref|XP_007204707.1| hypothetical protein PRUPE_ppa009801mg [Prun... 72 8e-11 ref|XP_003554059.1| PREDICTED: NADH--cytochrome b5 reductase 1 [... 72 8e-11 gb|EYU30340.1| hypothetical protein MIMGU_mgv1a011487mg [Mimulus... 72 1e-10 gb|ACU19291.1| unknown [Glycine max] 72 1e-10 ref|XP_002319200.1| hypothetical protein POPTR_0013s06360g [Popu... 72 1e-10 gb|AAV69019.1| NADH:cytochrome b5 reductase [Vernicia fordii] gi... 72 1e-10 ref|XP_006400320.1| hypothetical protein EUTSA_v10014327mg [Eutr... 71 1e-10 ref|NP_197279.1| NADH--cytochrome B5 reductase 1 [Arabidopsis th... 71 1e-10 gb|ABR25388.1| NADH cytochrome b5 reductase [Oryza sativa Indica... 71 1e-10 gb|AAL24304.1| NADH-cytochrome b5 reductase [Arabidopsis thalian... 71 1e-10 ref|NP_001044612.1| Os01g0814900 [Oryza sativa Japonica Group] g... 71 1e-10 ref|XP_006339205.1| PREDICTED: NADH--cytochrome b5 reductase 1-l... 71 2e-10 >ref|XP_006437259.1| hypothetical protein CICLE_v10032349mg [Citrus clementina] gi|568862667|ref|XP_006484798.1| PREDICTED: NADH--cytochrome b5 reductase 1-like [Citrus sinensis] gi|557539455|gb|ESR50499.1| hypothetical protein CICLE_v10032349mg [Citrus clementina] Length = 280 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = +2 Query: 2 HLPSPTSDIQILRCGPPPMNKAMAAHLEALGYASETLFQF 121 H P+P SDIQ+LRCGPPPMNKAMAAHLEALGY SE LFQF Sbjct: 241 HCPAPASDIQVLRCGPPPMNKAMAAHLEALGYTSEMLFQF 280 >ref|XP_006288397.1| hypothetical protein CARUB_v10001654mg [Capsella rubella] gi|482557103|gb|EOA21295.1| hypothetical protein CARUB_v10001654mg [Capsella rubella] Length = 281 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = +2 Query: 2 HLPSPTSDIQILRCGPPPMNKAMAAHLEALGYASETLFQF 121 H P+P SDIQILRCGPPPMNKAMAA+LEALGY+ E LFQF Sbjct: 242 HCPAPASDIQILRCGPPPMNKAMAANLEALGYSQEMLFQF 281 >ref|XP_003520929.1| PREDICTED: NADH--cytochrome b5 reductase 1 [Glycine max] Length = 278 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = +2 Query: 2 HLPSPTSDIQILRCGPPPMNKAMAAHLEALGYASETLFQF 121 H P+P DI+ILRCGPPPMNKAMAAHLEALGYASE FQF Sbjct: 239 HCPAPAQDIKILRCGPPPMNKAMAAHLEALGYASEMQFQF 278 >ref|XP_004144304.1| PREDICTED: NADH--cytochrome b5 reductase 1-like [Cucumis sativus] gi|449488287|ref|XP_004157991.1| PREDICTED: NADH--cytochrome b5 reductase 1-like [Cucumis sativus] Length = 281 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = +2 Query: 2 HLPSPTSDIQILRCGPPPMNKAMAAHLEALGYASETLFQF 121 H P+P SDIQILRCGPPPMNKAMAAHLE LGYA E LF F Sbjct: 242 HCPAPASDIQILRCGPPPMNKAMAAHLEELGYAPEMLFMF 281 >gb|EPS72506.1| hypothetical protein M569_02252, partial [Genlisea aurea] Length = 194 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +2 Query: 2 HLPSPTSDIQILRCGPPPMNKAMAAHLEALGYASETLFQF 121 H P+P SDIQILRCGPPPMNKAMA HL+ALGY SE FQF Sbjct: 155 HCPAPASDIQILRCGPPPMNKAMAGHLDALGYTSEMQFQF 194 >ref|XP_003564467.1| PREDICTED: NADH-cytochrome b5 reductase 1-like [Brachypodium distachyon] Length = 279 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +2 Query: 2 HLPSPTSDIQILRCGPPPMNKAMAAHLEALGYASETLFQF 121 H P+P DIQILRCGPPPMNKAMAAHLEALGY +E FQF Sbjct: 240 HCPAPAEDIQILRCGPPPMNKAMAAHLEALGYTNEMQFQF 279 >ref|XP_002527570.1| NADH-cytochrome B5 reductase, putative [Ricinus communis] gi|223533062|gb|EEF34822.1| NADH-cytochrome B5 reductase, putative [Ricinus communis] Length = 279 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +2 Query: 2 HLPSPTSDIQILRCGPPPMNKAMAAHLEALGYASETLFQF 121 H P P SD+QILRCGPPPMNKAMAAHL ALGY SE FQF Sbjct: 240 HCPPPASDVQILRCGPPPMNKAMAAHLNALGYTSEMQFQF 279 >ref|XP_007015531.1| NADH:cytochrome B5 reductase 1 [Theobroma cacao] gi|508785894|gb|EOY33150.1| NADH:cytochrome B5 reductase 1 [Theobroma cacao] Length = 420 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +2 Query: 2 HLPSPTSDIQILRCGPPPMNKAMAAHLEALGYASETLFQF 121 + P+P DIQILRCGPPPMNKAMAAHLEALGY+SE FQF Sbjct: 381 YCPAPAQDIQILRCGPPPMNKAMAAHLEALGYSSEMQFQF 420 >ref|XP_007204707.1| hypothetical protein PRUPE_ppa009801mg [Prunus persica] gi|462400238|gb|EMJ05906.1| hypothetical protein PRUPE_ppa009801mg [Prunus persica] Length = 277 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = +2 Query: 5 LPSPTSDIQILRCGPPPMNKAMAAHLEALGYASETLFQF 121 LP+P DIQILRCGPPPMNKAMAAHLEALGYA E FQF Sbjct: 239 LPAPAHDIQILRCGPPPMNKAMAAHLEALGYAPEMQFQF 277 >ref|XP_003554059.1| PREDICTED: NADH--cytochrome b5 reductase 1 [Glycine max] Length = 278 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +2 Query: 2 HLPSPTSDIQILRCGPPPMNKAMAAHLEALGYASETLFQF 121 H P+P DI+ILRCGPPPMNKAMAAHLEALGYA E FQF Sbjct: 239 HCPAPAQDIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF 278 >gb|EYU30340.1| hypothetical protein MIMGU_mgv1a011487mg [Mimulus guttatus] Length = 280 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 8 PSPTSDIQILRCGPPPMNKAMAAHLEALGYASETLFQF 121 P+P SDIQILRCGPPPMNKAMA HLEALGY+SE FQF Sbjct: 243 PAPASDIQILRCGPPPMNKAMAGHLEALGYSSEMQFQF 280 >gb|ACU19291.1| unknown [Glycine max] Length = 278 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +2 Query: 2 HLPSPTSDIQILRCGPPPMNKAMAAHLEALGYASETLFQF 121 H P+P DI+ILRCGPPPMNKAMAAHLEALGYA E FQF Sbjct: 239 HCPAPAQDIKILRCGPPPMNKAMAAHLEALGYAFEMQFQF 278 >ref|XP_002319200.1| hypothetical protein POPTR_0013s06360g [Populus trichocarpa] gi|222857576|gb|EEE95123.1| hypothetical protein POPTR_0013s06360g [Populus trichocarpa] Length = 280 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +2 Query: 2 HLPSPTSDIQILRCGPPPMNKAMAAHLEALGYASETLFQF 121 + P+P DI+ILRCGPPPMNKAMAAHLEALGYA E LFQF Sbjct: 241 YCPAPAPDIKILRCGPPPMNKAMAAHLEALGYAPEMLFQF 280 >gb|AAV69019.1| NADH:cytochrome b5 reductase [Vernicia fordii] gi|55979115|gb|AAV69021.1| NADH:cytochrome b5 reductase [Vernicia fordii] Length = 280 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +2 Query: 2 HLPSPTSDIQILRCGPPPMNKAMAAHLEALGYASETLFQF 121 H P+P SDIQILRCGPPPMNKAMAAHLEAL Y S+ FQF Sbjct: 241 HCPAPASDIQILRCGPPPMNKAMAAHLEALDYTSDMQFQF 280 >ref|XP_006400320.1| hypothetical protein EUTSA_v10014327mg [Eutrema salsugineum] gi|557101410|gb|ESQ41773.1| hypothetical protein EUTSA_v10014327mg [Eutrema salsugineum] Length = 281 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +2 Query: 2 HLPSPTSDIQILRCGPPPMNKAMAAHLEALGYASETLFQF 121 H P+P SDIQILRCGPPPMNKAMAA+LEALGY+ E FQF Sbjct: 242 HCPAPASDIQILRCGPPPMNKAMAANLEALGYSPEMQFQF 281 >ref|NP_197279.1| NADH--cytochrome B5 reductase 1 [Arabidopsis thaliana] gi|75274821|sp|Q9ZNT1.1|NB5R1_ARATH RecName: Full=NADH--cytochrome b5 reductase 1 gi|4240116|dbj|BAA74837.1| NADH-cytochrome b5 reductase [Arabidopsis thaliana] gi|4240118|dbj|BAA74838.1| NADH-cytochrome b5 reductase [Arabidopsis thaliana] gi|9759054|dbj|BAB09576.1| NADH-cytochrome b5 reductase [Arabidopsis thaliana] gi|21553853|gb|AAM62946.1| NADH-cytochrome b5 reductase [Arabidopsis thaliana] gi|222423046|dbj|BAH19505.1| AT5G17770 [Arabidopsis thaliana] gi|332005083|gb|AED92466.1| NADH--cytochrome B5 reductase 1 [Arabidopsis thaliana] Length = 281 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +2 Query: 2 HLPSPTSDIQILRCGPPPMNKAMAAHLEALGYASETLFQF 121 H P+P SDIQILRCGPPPMNKAMAA+LEALGY+ E FQF Sbjct: 242 HCPAPASDIQILRCGPPPMNKAMAANLEALGYSPEMQFQF 281 >gb|ABR25388.1| NADH cytochrome b5 reductase [Oryza sativa Indica Group] Length = 169 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = +2 Query: 2 HLPSPTSDIQILRCGPPPMNKAMAAHLEALGYASETLFQF 121 HLP+P DIQILRCGPPPMNKAMAAHL+ LGY E FQF Sbjct: 130 HLPAPAEDIQILRCGPPPMNKAMAAHLDELGYTKEMQFQF 169 >gb|AAL24304.1| NADH-cytochrome b5 reductase [Arabidopsis thaliana] gi|18377462|gb|AAL66897.1| NADH-cytochrome b5 reductase [Arabidopsis thaliana] Length = 164 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +2 Query: 2 HLPSPTSDIQILRCGPPPMNKAMAAHLEALGYASETLFQF 121 H P+P SDIQILRCGPPPMNKAMAA+LEALGY+ E FQF Sbjct: 125 HCPAPASDIQILRCGPPPMNKAMAANLEALGYSPEMQFQF 164 >ref|NP_001044612.1| Os01g0814900 [Oryza sativa Japonica Group] gi|56785057|dbj|BAD82696.1| putative cytochrome b5 reductase [Oryza sativa Japonica Group] gi|113534143|dbj|BAF06526.1| Os01g0814900 [Oryza sativa Japonica Group] gi|125528147|gb|EAY76261.1| hypothetical protein OsI_04196 [Oryza sativa Indica Group] gi|125572415|gb|EAZ13930.1| hypothetical protein OsJ_03855 [Oryza sativa Japonica Group] gi|215678913|dbj|BAG96343.1| unnamed protein product [Oryza sativa Japonica Group] gi|215701309|dbj|BAG92733.1| unnamed protein product [Oryza sativa Japonica Group] gi|215765051|dbj|BAG86748.1| unnamed protein product [Oryza sativa Japonica Group] Length = 279 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = +2 Query: 2 HLPSPTSDIQILRCGPPPMNKAMAAHLEALGYASETLFQF 121 HLP+P DIQILRCGPPPMNKAMAAHL+ LGY E FQF Sbjct: 240 HLPAPAEDIQILRCGPPPMNKAMAAHLDELGYTKEMQFQF 279 >ref|XP_006339205.1| PREDICTED: NADH--cytochrome b5 reductase 1-like isoform X1 [Solanum tuberosum] gi|565344202|ref|XP_006339206.1| PREDICTED: NADH--cytochrome b5 reductase 1-like isoform X2 [Solanum tuberosum] Length = 278 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = +2 Query: 2 HLPSPTSDIQILRCGPPPMNKAMAAHLEALGYASETLFQF 121 H P+P DI+ILRCGPPPMNKAMAAHLEALGY+ E FQF Sbjct: 239 HCPAPADDIKILRCGPPPMNKAMAAHLEALGYSPEMQFQF 278