BLASTX nr result
ID: Mentha27_contig00013126
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00013126 (559 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19982.1| hypothetical protein MIMGU_mgv1a024988mg [Mimulus... 57 4e-06 >gb|EYU19982.1| hypothetical protein MIMGU_mgv1a024988mg [Mimulus guttatus] Length = 307 Score = 56.6 bits (135), Expect = 4e-06 Identities = 30/69 (43%), Positives = 37/69 (53%), Gaps = 2/69 (2%) Frame = +1 Query: 298 VDYTPYDYHKRSVGKPXXXXXXXXXXXXXXXXXXXX--DEGIKYEEEKIAERMENDMVST 471 VDYTPYDY KR+ KP +EG+KYEEEKIA R++ND+ S+ Sbjct: 238 VDYTPYDYQKRNSSKPGIGLGTGLAVGAVAGAMGGLALEEGVKYEEEKIAARVDNDLASS 297 Query: 472 SRVSTARDD 498 R S R D Sbjct: 298 DRYSEYRSD 306