BLASTX nr result
ID: Mentha27_contig00012751
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00012751 (486 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26127.1| hypothetical protein MIMGU_mgv1a001622mg [Mimulus... 61 2e-07 >gb|EYU26127.1| hypothetical protein MIMGU_mgv1a001622mg [Mimulus guttatus] Length = 783 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +2 Query: 2 AEPEFRPLMSEVVQDLMQLIRRESPHRSEED 94 AEPEFRPLMSEVVQDLMQLIRRESP RS+ED Sbjct: 753 AEPEFRPLMSEVVQDLMQLIRRESPRRSDED 783