BLASTX nr result
ID: Mentha27_contig00012522
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00012522 (246 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45446.1| hypothetical protein MIMGU_mgv1a026677mg [Mimulus... 59 7e-07 >gb|EYU45446.1| hypothetical protein MIMGU_mgv1a026677mg [Mimulus guttatus] Length = 394 Score = 58.9 bits (141), Expect = 7e-07 Identities = 35/73 (47%), Positives = 43/73 (58%), Gaps = 1/73 (1%) Frame = -3 Query: 241 GEETRDVDTIKTGSSAEMENESKKLLRLNYEAVIAAWATQSNSNSPWTDGIRPQFD-LDL 65 GE+T+ + S +E N + LRLNYEAVIAAWAT+ PWT+G PQFD LD Sbjct: 246 GEKTKSEEE-DMSSRSESHNNNNMFLRLNYEAVIAAWATK---GCPWTNGTPPQFDNLDQ 301 Query: 64 IMSACLDEEWGGG 26 M +EW GG Sbjct: 302 FM-----DEWSGG 309