BLASTX nr result
ID: Mentha27_contig00012451
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00012451 (689 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGT37060.1| omega-3 fatty acid desaturase [Perilla frutescens] 67 4e-09 gb|AAD15744.1| omega-3 fatty acid desaturase [Perilla frutescens] 67 4e-09 gb|AAL36934.1|AF213482_1 delta-15 desaturase [Perilla frutescens] 67 7e-09 ref|NP_850139.1| omega-3 fatty acid desaturase [Arabidopsis thal... 64 6e-08 dbj|BAO20208.1| microsomal omega-3 fatty acid desaturase [Nicoti... 62 2e-07 sp|P48626.1|FAD3E_TOBAC RecName: Full=Omega-3 fatty acid desatur... 62 2e-07 ref|XP_006852487.1| hypothetical protein AMTR_s00021p00138650 [A... 62 2e-07 gb|AFJ19038.1| fatty acid desaturase BnaC.fad3.b-SW_Hickory [Bra... 62 2e-07 ref|XP_007205342.1| hypothetical protein PRUPE_ppa007057mg [Prun... 61 4e-07 emb|CAC18722.1| putative plastidial w-3 fatty acid desaturase [P... 61 4e-07 gb|ABR16036.1| unknown [Picea sitchensis] 61 4e-07 ref|XP_006410048.1| hypothetical protein EUTSA_v10016786mg [Eutr... 60 5e-07 ref|XP_006294257.1| hypothetical protein CARUB_v10023252mg, part... 60 5e-07 ref|NP_180559.1| omega-3 fatty acid desaturase [Arabidopsis thal... 60 5e-07 sp|P48624.1|FAD3E_BRANA RecName: Full=Omega-3 fatty acid desatur... 60 5e-07 gb|AFJ19040.1| fatty acid desaturase BnaC.FAD3.a [Brassica napus... 60 5e-07 gb|AFJ19034.1| fatty acid desaturase BnaC.FAD3.c [Brassica napus] 60 5e-07 gb|AFJ19033.1| fatty acid desaturase BnaA.FAD3.c [Brassica napus] 60 5e-07 gb|AFJ19039.1| fatty acid desaturase BnaA.FAD3.a [Brassica napus] 60 5e-07 gb|AEF80000.1| fatty acid desaturase 3 [Corylus heterophylla] 60 5e-07 >gb|AGT37060.1| omega-3 fatty acid desaturase [Perilla frutescens] Length = 391 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +2 Query: 2 IFVMWLDTVTYLHHHGYDKKLPWYRSKVISF 94 IFVMWLDTVTYLHHHGYDKKLPWYRSK S+ Sbjct: 259 IFVMWLDTVTYLHHHGYDKKLPWYRSKEWSY 289 >gb|AAD15744.1| omega-3 fatty acid desaturase [Perilla frutescens] Length = 391 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +2 Query: 2 IFVMWLDTVTYLHHHGYDKKLPWYRSKVISF 94 IFVMWLDTVTYLHHHGYDKKLPWYRSK S+ Sbjct: 259 IFVMWLDTVTYLHHHGYDKKLPWYRSKEWSY 289 >gb|AAL36934.1|AF213482_1 delta-15 desaturase [Perilla frutescens] Length = 390 Score = 66.6 bits (161), Expect = 7e-09 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 2 IFVMWLDTVTYLHHHGYDKKLPWYRSK 82 IFVMWLDTVTYLHHHGYDKKLPWYRSK Sbjct: 258 IFVMWLDTVTYLHHHGYDKKLPWYRSK 284 >ref|NP_850139.1| omega-3 fatty acid desaturase [Arabidopsis thaliana] gi|330253237|gb|AEC08331.1| omega-3 fatty acid desaturase [Arabidopsis thaliana] Length = 288 Score = 63.5 bits (153), Expect = 6e-08 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = +2 Query: 2 IFVMWLDTVTYLHHHGYDKKLPWYRSKVISFSFFLF 109 IFVMWLD VTYLHHHG+D+KLPWYR KV + F Sbjct: 249 IFVMWLDAVTYLHHHGHDEKLPWYRGKVSKIKYICF 284 >dbj|BAO20208.1| microsomal omega-3 fatty acid desaturase [Nicotiana tabacum] Length = 379 Score = 62.0 bits (149), Expect = 2e-07 Identities = 33/67 (49%), Positives = 41/67 (61%), Gaps = 10/67 (14%) Frame = +2 Query: 2 IFVMWLDTVTYLHHHGYDKKLPWYRSKVISF----------SFFLFNFCH*LMFSNILCT 151 IFVMWLD VTYLHHHGY+KKLPWYR K S+ + LFN H + ++++ Sbjct: 245 IFVMWLDFVTYLHHHGYEKKLPWYRGKEWSYLRGGLTTVDRDYGLFNNIHHDIGTHVI-- 302 Query: 152 VHYFTQI 172 H F QI Sbjct: 303 HHLFPQI 309 >sp|P48626.1|FAD3E_TOBAC RecName: Full=Omega-3 fatty acid desaturase, endoplasmic reticulum gi|599592|dbj|BAA05515.1| microsomal omega-3 acid desaturase [Nicotiana tabacum] gi|21668484|dbj|BAC01273.1| microsomal omega-3 fatty acid desaturase [Nicotiana tabacum] Length = 379 Score = 62.0 bits (149), Expect = 2e-07 Identities = 33/67 (49%), Positives = 41/67 (61%), Gaps = 10/67 (14%) Frame = +2 Query: 2 IFVMWLDTVTYLHHHGYDKKLPWYRSKVISF----------SFFLFNFCH*LMFSNILCT 151 IFVMWLD VTYLHHHGY+KKLPWYR K S+ + LFN H + ++++ Sbjct: 245 IFVMWLDFVTYLHHHGYEKKLPWYRGKEWSYLRGGLTTVDRDYGLFNNIHHDIGTHVI-- 302 Query: 152 VHYFTQI 172 H F QI Sbjct: 303 HHLFPQI 309 >ref|XP_006852487.1| hypothetical protein AMTR_s00021p00138650 [Amborella trichopoda] gi|548856098|gb|ERN13954.1| hypothetical protein AMTR_s00021p00138650 [Amborella trichopoda] Length = 418 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +2 Query: 2 IFVMWLDTVTYLHHHGYDKKLPWYRSKVISF 94 IFVMWLD VTYLHHHGY+KKLPWYR K S+ Sbjct: 282 IFVMWLDFVTYLHHHGYEKKLPWYRGKEWSY 312 >gb|AFJ19038.1| fatty acid desaturase BnaC.fad3.b-SW_Hickory [Brassica napus] Length = 282 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = +2 Query: 2 IFVMWLDTVTYLHHHGYDKKLPWYRSKVISFSFFL 106 IFVMWLD VTYLHHHG+D KLPWYR K+ + F+ Sbjct: 243 IFVMWLDAVTYLHHHGHDDKLPWYRGKISRSTLFI 277 >ref|XP_007205342.1| hypothetical protein PRUPE_ppa007057mg [Prunus persica] gi|462400984|gb|EMJ06541.1| hypothetical protein PRUPE_ppa007057mg [Prunus persica] Length = 384 Score = 60.8 bits (146), Expect = 4e-07 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +2 Query: 2 IFVMWLDTVTYLHHHGYDKKLPWYRSKVISF 94 IF+MW+D VTYLHHHGYD+KLPWYR K S+ Sbjct: 249 IFIMWIDLVTYLHHHGYDQKLPWYRGKEWSY 279 >emb|CAC18722.1| putative plastidial w-3 fatty acid desaturase [Picea abies] Length = 449 Score = 60.8 bits (146), Expect = 4e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +2 Query: 2 IFVMWLDTVTYLHHHGYDKKLPWYRSKVISF 94 IFVMWLD VTYLHHHGYD+K+PWYR K S+ Sbjct: 318 IFVMWLDLVTYLHHHGYDEKVPWYRGKEWSY 348 >gb|ABR16036.1| unknown [Picea sitchensis] Length = 449 Score = 60.8 bits (146), Expect = 4e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +2 Query: 2 IFVMWLDTVTYLHHHGYDKKLPWYRSKVISF 94 IFVMWLD VTYLHHHGYD+K+PWYR K S+ Sbjct: 318 IFVMWLDLVTYLHHHGYDEKVPWYRGKEWSY 348 >ref|XP_006410048.1| hypothetical protein EUTSA_v10016786mg [Eutrema salsugineum] gi|557111217|gb|ESQ51501.1| hypothetical protein EUTSA_v10016786mg [Eutrema salsugineum] Length = 385 Score = 60.5 bits (145), Expect = 5e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +2 Query: 2 IFVMWLDTVTYLHHHGYDKKLPWYRSKVISF 94 IFVMWLD VTYLHHHG+D+KLPWYR K S+ Sbjct: 248 IFVMWLDAVTYLHHHGHDEKLPWYRGKEWSY 278 >ref|XP_006294257.1| hypothetical protein CARUB_v10023252mg, partial [Capsella rubella] gi|482562965|gb|EOA27155.1| hypothetical protein CARUB_v10023252mg, partial [Capsella rubella] Length = 432 Score = 60.5 bits (145), Expect = 5e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +2 Query: 2 IFVMWLDTVTYLHHHGYDKKLPWYRSKVISF 94 IFVMWLD VTYLHHHG+D+KLPWYR K S+ Sbjct: 295 IFVMWLDAVTYLHHHGHDEKLPWYRGKEWSY 325 >ref|NP_180559.1| omega-3 fatty acid desaturase [Arabidopsis thaliana] gi|1345973|sp|P48623.1|FAD3E_ARATH RecName: Full=Omega-3 fatty acid desaturase, endoplasmic reticulum gi|408483|gb|AAA61778.1| omega-3 fatty acid desaturase [Arabidopsis thaliana] gi|471091|dbj|BAA04505.1| fatty acid desaturase [Arabidopsis thaliana] gi|1197795|dbj|BAA05514.1| microsomal omega-3 fatty acid desaturase [Arabidopsis thaliana] gi|3420053|gb|AAC31854.1| omega-3 fatty acid desaturase [Arabidopsis thaliana] gi|17381020|gb|AAL36322.1| putative omega-3 fatty acid desaturase [Arabidopsis thaliana] gi|20465899|gb|AAM20102.1| putative omega-3 fatty acid desaturase [Arabidopsis thaliana] gi|330253236|gb|AEC08330.1| omega-3 fatty acid desaturase [Arabidopsis thaliana] Length = 386 Score = 60.5 bits (145), Expect = 5e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +2 Query: 2 IFVMWLDTVTYLHHHGYDKKLPWYRSKVISF 94 IFVMWLD VTYLHHHG+D+KLPWYR K S+ Sbjct: 249 IFVMWLDAVTYLHHHGHDEKLPWYRGKEWSY 279 >sp|P48624.1|FAD3E_BRANA RecName: Full=Omega-3 fatty acid desaturase, endoplasmic reticulum gi|167148|gb|AAA32994.1| linoleic acid desaturase [Brassica napus] Length = 383 Score = 60.5 bits (145), Expect = 5e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +2 Query: 2 IFVMWLDTVTYLHHHGYDKKLPWYRSKVISF 94 IFVMWLD VTYLHHHG+D+KLPWYR K S+ Sbjct: 246 IFVMWLDAVTYLHHHGHDEKLPWYRGKEWSY 276 >gb|AFJ19040.1| fatty acid desaturase BnaC.FAD3.a [Brassica napus] gi|461939705|gb|AGH20190.1| fatty acid desaturase 3-2 [Brassica oleracea] Length = 383 Score = 60.5 bits (145), Expect = 5e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +2 Query: 2 IFVMWLDTVTYLHHHGYDKKLPWYRSKVISF 94 IFVMWLD VTYLHHHG+D+KLPWYR K S+ Sbjct: 246 IFVMWLDAVTYLHHHGHDEKLPWYRGKEWSY 276 >gb|AFJ19034.1| fatty acid desaturase BnaC.FAD3.c [Brassica napus] Length = 383 Score = 60.5 bits (145), Expect = 5e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +2 Query: 2 IFVMWLDTVTYLHHHGYDKKLPWYRSKVISF 94 IFVMWLD VTYLHHHG+D+KLPWYR K S+ Sbjct: 246 IFVMWLDAVTYLHHHGHDEKLPWYRGKEWSY 276 >gb|AFJ19033.1| fatty acid desaturase BnaA.FAD3.c [Brassica napus] Length = 383 Score = 60.5 bits (145), Expect = 5e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +2 Query: 2 IFVMWLDTVTYLHHHGYDKKLPWYRSKVISF 94 IFVMWLD VTYLHHHG+D+KLPWYR K S+ Sbjct: 246 IFVMWLDAVTYLHHHGHDEKLPWYRGKEWSY 276 >gb|AFJ19039.1| fatty acid desaturase BnaA.FAD3.a [Brassica napus] Length = 383 Score = 60.5 bits (145), Expect = 5e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +2 Query: 2 IFVMWLDTVTYLHHHGYDKKLPWYRSKVISF 94 IFVMWLD VTYLHHHG+D+KLPWYR K S+ Sbjct: 246 IFVMWLDAVTYLHHHGHDEKLPWYRGKEWSY 276 >gb|AEF80000.1| fatty acid desaturase 3 [Corylus heterophylla] Length = 386 Score = 60.5 bits (145), Expect = 5e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +2 Query: 2 IFVMWLDTVTYLHHHGYDKKLPWYRSKVISF 94 IFVMWLD VTYLHHHGY++KLPWYR K S+ Sbjct: 251 IFVMWLDLVTYLHHHGYEQKLPWYRGKEWSY 281