BLASTX nr result
ID: Mentha27_contig00012107
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00012107 (227 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40850.1| hypothetical protein MIMGU_mgv1a003003mg [Mimulus... 73 4e-11 gb|EYU22617.1| hypothetical protein MIMGU_mgv1a003082mg [Mimulus... 60 2e-07 ref|XP_007036413.1| Binding-like protein isoform 5, partial [The... 57 2e-06 ref|XP_007036412.1| Binding-like protein isoform 4 [Theobroma ca... 57 2e-06 ref|XP_007036411.1| Binding-like protein isoform 3 [Theobroma ca... 57 2e-06 ref|XP_007036410.1| Binding-like protein isoform 2 [Theobroma ca... 57 2e-06 ref|XP_007036409.1| Binding-like protein isoform 1 [Theobroma ca... 57 2e-06 >gb|EYU40850.1| hypothetical protein MIMGU_mgv1a003003mg [Mimulus guttatus] Length = 616 Score = 73.2 bits (178), Expect = 4e-11 Identities = 42/76 (55%), Positives = 47/76 (61%), Gaps = 2/76 (2%) Frame = +3 Query: 3 SGLPSLGPFS--VTENAGTTTSINSKSVAPGTAALPQQNIPQPVTSNAGASGSGLMETPT 176 S LP P++ V +N+G + S PG AAL Q NIPQPVTS AGA GS E T Sbjct: 307 SSLPPSAPYATPVPDNSGINPVASKPSAVPGPAALSQPNIPQPVTSVAGAPGSVSSEILT 366 Query: 177 PSLITPGQLLQSGPPT 224 SLITPG LLQSGP T Sbjct: 367 HSLITPGHLLQSGPST 382 >gb|EYU22617.1| hypothetical protein MIMGU_mgv1a003082mg [Mimulus guttatus] Length = 609 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/63 (50%), Positives = 39/63 (61%) Frame = +3 Query: 30 SVTENAGTTTSINSKSVAPGTAALPQQNIPQPVTSNAGASGSGLMETPTPSLITPGQLLQ 209 S+ +NA + ++ S PG AALPQQ + P S A S + ET TPSLITPGQ LQ Sbjct: 315 SMPDNAAVNSVVSKPSTVPGLAALPQQTMTHPGAS-ASVVSSSVSETLTPSLITPGQFLQ 373 Query: 210 SGP 218 SGP Sbjct: 374 SGP 376 >ref|XP_007036413.1| Binding-like protein isoform 5, partial [Theobroma cacao] gi|508773658|gb|EOY20914.1| Binding-like protein isoform 5, partial [Theobroma cacao] Length = 566 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/64 (46%), Positives = 36/64 (56%) Frame = +3 Query: 36 TENAGTTTSINSKSVAPGTAALPQQNIPQPVTSNAGASGSGLMETPTPSLITPGQLLQSG 215 T N SKS T++ P N+P P G SGS +E PTPSL+TPGQLLQS Sbjct: 353 TNNIALQFGEKSKSTLGSTSSYP--NMPTPTPPIVGTSGSNQLEVPTPSLVTPGQLLQSA 410 Query: 216 PPTP 227 P +P Sbjct: 411 PTSP 414 >ref|XP_007036412.1| Binding-like protein isoform 4 [Theobroma cacao] gi|508773657|gb|EOY20913.1| Binding-like protein isoform 4 [Theobroma cacao] Length = 544 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/64 (46%), Positives = 36/64 (56%) Frame = +3 Query: 36 TENAGTTTSINSKSVAPGTAALPQQNIPQPVTSNAGASGSGLMETPTPSLITPGQLLQSG 215 T N SKS T++ P N+P P G SGS +E PTPSL+TPGQLLQS Sbjct: 353 TNNIALQFGEKSKSTLGSTSSYP--NMPTPTPPIVGTSGSNQLEVPTPSLVTPGQLLQSA 410 Query: 216 PPTP 227 P +P Sbjct: 411 PTSP 414 >ref|XP_007036411.1| Binding-like protein isoform 3 [Theobroma cacao] gi|508773656|gb|EOY20912.1| Binding-like protein isoform 3 [Theobroma cacao] Length = 685 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/64 (46%), Positives = 36/64 (56%) Frame = +3 Query: 36 TENAGTTTSINSKSVAPGTAALPQQNIPQPVTSNAGASGSGLMETPTPSLITPGQLLQSG 215 T N SKS T++ P N+P P G SGS +E PTPSL+TPGQLLQS Sbjct: 353 TNNIALQFGEKSKSTLGSTSSYP--NMPTPTPPIVGTSGSNQLEVPTPSLVTPGQLLQSA 410 Query: 216 PPTP 227 P +P Sbjct: 411 PTSP 414 >ref|XP_007036410.1| Binding-like protein isoform 2 [Theobroma cacao] gi|508773655|gb|EOY20911.1| Binding-like protein isoform 2 [Theobroma cacao] Length = 695 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/64 (46%), Positives = 36/64 (56%) Frame = +3 Query: 36 TENAGTTTSINSKSVAPGTAALPQQNIPQPVTSNAGASGSGLMETPTPSLITPGQLLQSG 215 T N SKS T++ P N+P P G SGS +E PTPSL+TPGQLLQS Sbjct: 325 TNNIALQFGEKSKSTLGSTSSYP--NMPTPTPPIVGTSGSNQLEVPTPSLVTPGQLLQSA 382 Query: 216 PPTP 227 P +P Sbjct: 383 PTSP 386 >ref|XP_007036409.1| Binding-like protein isoform 1 [Theobroma cacao] gi|508773654|gb|EOY20910.1| Binding-like protein isoform 1 [Theobroma cacao] Length = 723 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/64 (46%), Positives = 36/64 (56%) Frame = +3 Query: 36 TENAGTTTSINSKSVAPGTAALPQQNIPQPVTSNAGASGSGLMETPTPSLITPGQLLQSG 215 T N SKS T++ P N+P P G SGS +E PTPSL+TPGQLLQS Sbjct: 353 TNNIALQFGEKSKSTLGSTSSYP--NMPTPTPPIVGTSGSNQLEVPTPSLVTPGQLLQSA 410 Query: 216 PPTP 227 P +P Sbjct: 411 PTSP 414