BLASTX nr result
ID: Mentha27_contig00011809
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00011809 (205 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17579.1| hypothetical protein MIMGU_mgv1a015014mg [Mimulus... 83 3e-14 emb|CAA75118.1| fimbriata-associated protein [Antirrhinum majus] 82 8e-14 emb|CAA75117.1| fimbriata-associated protein [Antirrhinum majus] 82 8e-14 emb|CAJ38400.1| fimbriata-associated protein [Plantago major] 79 5e-13 gb|EMS35771.1| SKP1-like protein 1B [Triticum urartu] 77 2e-12 gb|EXB60668.1| SKP1-like protein 1B [Morus notabilis] 74 2e-11 dbj|BAJ53099.1| JHL20J20.6 [Jatropha curcas] 74 2e-11 gb|ABS17589.1| SKP1 component-like 1 [Humulus lupulus] 74 2e-11 ref|XP_002270061.1| PREDICTED: SKP1-like protein 1B isoform 2 [V... 74 2e-11 ref|XP_004248652.1| PREDICTED: SKP1-like protein 1A-like [Solanu... 74 3e-11 ref|NP_565123.1| S-phase kinase-associated protein 1 [Arabidopsi... 73 4e-11 emb|CAJ38399.1| fimbriata-associated protein [Plantago major] 73 4e-11 ref|XP_007041813.1| S phase kinase-associated protein 1 [Theobro... 73 5e-11 gb|EMT03937.1| SKP1-like protein 1A [Aegilops tauschii] 73 5e-11 gb|AAC63273.1| SKP1-like protein [Nicotiana clevelandii] 73 5e-11 gb|AAO85510.1| SKP1 [Nicotiana benthamiana] 73 5e-11 ref|XP_006435227.1| hypothetical protein CICLE_v10002751mg [Citr... 72 6e-11 ref|XP_004287783.1| PREDICTED: SKP1-like protein 1A-like [Fragar... 72 6e-11 ref|XP_004250724.1| PREDICTED: SKP1-like protein 1A-like isoform... 72 6e-11 ref|XP_004250723.1| PREDICTED: SKP1-like protein 1A-like isoform... 72 6e-11 >gb|EYU17579.1| hypothetical protein MIMGU_mgv1a015014mg [Mimulus guttatus] Length = 170 Score = 83.2 bits (204), Expect = 3e-14 Identities = 44/69 (63%), Positives = 46/69 (66%), Gaps = 1/69 (1%) Frame = -1 Query: 205 HMIEDDCVDNVIPIPNVTGKILSKVIEYCKRH-XXXXXXXXXXXXXXXXXXXXXELKVFD 29 HMIEDDC DNVIP+PNVTGKILSKVIEYCKRH +LKVFD Sbjct: 38 HMIEDDCADNVIPLPNVTGKILSKVIEYCKRHVDAAASATKADDKLASAAASDEDLKVFD 97 Query: 28 ADFVKVDQA 2 ADFVKVDQA Sbjct: 98 ADFVKVDQA 106 >emb|CAA75118.1| fimbriata-associated protein [Antirrhinum majus] Length = 165 Score = 82.0 bits (201), Expect = 8e-14 Identities = 43/68 (63%), Positives = 45/68 (66%) Frame = -1 Query: 205 HMIEDDCVDNVIPIPNVTGKILSKVIEYCKRHXXXXXXXXXXXXXXXXXXXXXELKVFDA 26 HMIEDDC DNVIP+PNVTGKILSKVIEYCKRH +LK FDA Sbjct: 35 HMIEDDCADNVIPLPNVTGKILSKVIEYCKRH-VDADAAKSEEKVAAAAAGDDDLKAFDA 93 Query: 25 DFVKVDQA 2 DFVKVDQA Sbjct: 94 DFVKVDQA 101 >emb|CAA75117.1| fimbriata-associated protein [Antirrhinum majus] Length = 161 Score = 82.0 bits (201), Expect = 8e-14 Identities = 44/68 (64%), Positives = 45/68 (66%) Frame = -1 Query: 205 HMIEDDCVDNVIPIPNVTGKILSKVIEYCKRHXXXXXXXXXXXXXXXXXXXXXELKVFDA 26 HMIEDDC DNVIP+PNVTGKILSKVIEYCKRH ELK FDA Sbjct: 31 HMIEDDCADNVIPLPNVTGKILSKVIEYCKRH-VDAAAAKADDKLASTGTSDDELKAFDA 89 Query: 25 DFVKVDQA 2 DFVKVDQA Sbjct: 90 DFVKVDQA 97 >emb|CAJ38400.1| fimbriata-associated protein [Plantago major] Length = 186 Score = 79.3 bits (194), Expect = 5e-13 Identities = 42/71 (59%), Positives = 44/71 (61%), Gaps = 3/71 (4%) Frame = -1 Query: 205 HMIEDDCVDNVIPIPNVTGKILSKVIEYCKRH---XXXXXXXXXXXXXXXXXXXXXELKV 35 HMIEDDC DNVIP+PNVTGKILSKVIEYCKRH +LK Sbjct: 52 HMIEDDCADNVIPLPNVTGKILSKVIEYCKRHVDAAAANTAAKAEDKLASTAPTDDDLKA 111 Query: 34 FDADFVKVDQA 2 FD DFVKVDQA Sbjct: 112 FDTDFVKVDQA 122 >gb|EMS35771.1| SKP1-like protein 1B [Triticum urartu] Length = 167 Score = 77.4 bits (189), Expect = 2e-12 Identities = 38/68 (55%), Positives = 43/68 (63%) Frame = -1 Query: 205 HMIEDDCVDNVIPIPNVTGKILSKVIEYCKRHXXXXXXXXXXXXXXXXXXXXXELKVFDA 26 HMIEDDC DN IP+PNV KILSKVIEYCK+H +LK+FDA Sbjct: 36 HMIEDDCADNGIPLPNVDSKILSKVIEYCKKHVQADSTDASSSTSTAAAAPAEDLKIFDA 95 Query: 25 DFVKVDQA 2 +FVKVDQA Sbjct: 96 EFVKVDQA 103 >gb|EXB60668.1| SKP1-like protein 1B [Morus notabilis] Length = 157 Score = 73.9 bits (180), Expect = 2e-11 Identities = 39/68 (57%), Positives = 43/68 (63%) Frame = -1 Query: 205 HMIEDDCVDNVIPIPNVTGKILSKVIEYCKRHXXXXXXXXXXXXXXXXXXXXXELKVFDA 26 HMIEDDC DN IP+PNVT KILSKVIEYCK+H +LK +DA Sbjct: 32 HMIEDDCADNGIPLPNVTSKILSKVIEYCKKH------VEAPKSDDRASSADDDLKAWDA 85 Query: 25 DFVKVDQA 2 DFVKVDQA Sbjct: 86 DFVKVDQA 93 >dbj|BAJ53099.1| JHL20J20.6 [Jatropha curcas] Length = 100 Score = 73.9 bits (180), Expect = 2e-11 Identities = 40/68 (58%), Positives = 43/68 (63%) Frame = -1 Query: 205 HMIEDDCVDNVIPIPNVTGKILSKVIEYCKRHXXXXXXXXXXXXXXXXXXXXXELKVFDA 26 HMIEDDC DN IP+PNVT KILSKVIEYCK+H ELK +DA Sbjct: 32 HMIEDDCADNGIPLPNVTSKILSKVIEYCKKH------VETPKSDDRPSSADEELKTWDA 85 Query: 25 DFVKVDQA 2 DFVKVDQA Sbjct: 86 DFVKVDQA 93 >gb|ABS17589.1| SKP1 component-like 1 [Humulus lupulus] Length = 157 Score = 73.9 bits (180), Expect = 2e-11 Identities = 40/68 (58%), Positives = 43/68 (63%) Frame = -1 Query: 205 HMIEDDCVDNVIPIPNVTGKILSKVIEYCKRHXXXXXXXXXXXXXXXXXXXXXELKVFDA 26 HMIEDDC DN IP+PNVT KILSKVIEYCK+H ELK +DA Sbjct: 32 HMIEDDCADNGIPLPNVTSKILSKVIEYCKKH------VGAPKAEDRASSVDDELKAWDA 85 Query: 25 DFVKVDQA 2 DFVKVDQA Sbjct: 86 DFVKVDQA 93 >ref|XP_002270061.1| PREDICTED: SKP1-like protein 1B isoform 2 [Vitis vinifera] gi|147788379|emb|CAN76662.1| hypothetical protein VITISV_040452 [Vitis vinifera] Length = 156 Score = 73.9 bits (180), Expect = 2e-11 Identities = 40/68 (58%), Positives = 43/68 (63%) Frame = -1 Query: 205 HMIEDDCVDNVIPIPNVTGKILSKVIEYCKRHXXXXXXXXXXXXXXXXXXXXXELKVFDA 26 HMIEDDC DN IP+PNVT KILSKVIEYCK+H ELK +DA Sbjct: 32 HMIEDDCADNGIPLPNVTSKILSKVIEYCKKH-------VEAPKPEERSGVDEELKAWDA 84 Query: 25 DFVKVDQA 2 DFVKVDQA Sbjct: 85 DFVKVDQA 92 >ref|XP_004248652.1| PREDICTED: SKP1-like protein 1A-like [Solanum lycopersicum] Length = 150 Score = 73.6 bits (179), Expect = 3e-11 Identities = 37/68 (54%), Positives = 44/68 (64%) Frame = -1 Query: 205 HMIEDDCVDNVIPIPNVTGKILSKVIEYCKRHXXXXXXXXXXXXXXXXXXXXXELKVFDA 26 HMIEDDC +N IP+PNVTGKIL+KVI+YCKRH +LK FDA Sbjct: 27 HMIEDDCANNTIPVPNVTGKILAKVIKYCKRH--------VEVSKAEDNTAKEDLKTFDA 78 Query: 25 DFVKVDQA 2 +FVKVDQ+ Sbjct: 79 EFVKVDQS 86 >ref|NP_565123.1| S-phase kinase-associated protein 1 [Arabidopsis thaliana] gi|71153764|sp|Q39255.1|SKP1A_ARATH RecName: Full=SKP1-like protein 1A; Short=SKP1-like 1; AltName: Full=UFO-binding protein 1 gi|146387657|pdb|2P1M|A Chain A, Tir1-ask1 Complex Structure gi|146387659|pdb|2P1N|A Chain A, Mechanism Of Auxin Perception By The Tir1 Ubiqutin Ligase gi|146387662|pdb|2P1N|D Chain D, Mechanism Of Auxin Perception By The Tir1 Ubiqutin Ligase gi|146387665|pdb|2P1O|A Chain A, Mechanism Of Auxin Perception By The Tir1 Ubiquitin Ligase gi|146387668|pdb|2P1P|A Chain A, Mechanism Of Auxin Perception By The Tir1 Ubiquitin Ligase gi|146387670|pdb|2P1Q|A Chain A, Mechanism Of Auxin Perception By The Tir1 Ubiquitin Ligase gi|185177933|pdb|3C6N|A Chain A, Small Molecule Agonists And Antagonists Of F-Box Protein- Substrate Interactions In Auxin Perception And Signaling gi|185177935|pdb|3C6O|A Chain A, Small Molecule Agonists And Antagonists Of F-Box Protein-Substrate Interactions In Auxin Perception And Signaling gi|185177937|pdb|3C6P|A Chain A, Small Molecule Agonists And Antagonists Of F-Box Protein- Substrate Interactions In Auxin Perception And Signaling gi|308388069|pdb|3OGK|A Chain A, Structure Of Coi1-Ask1 In Complex With Coronatine And An Incomplete Jaz1 Degron gi|308388072|pdb|3OGK|C Chain C, Structure Of Coi1-Ask1 In Complex With Coronatine And An Incomplete Jaz1 Degron gi|308388075|pdb|3OGK|E Chain E, Structure Of Coi1-Ask1 In Complex With Coronatine And An Incomplete Jaz1 Degron gi|308388078|pdb|3OGK|G Chain G, Structure Of Coi1-Ask1 In Complex With Coronatine And An Incomplete Jaz1 Degron gi|308388080|pdb|3OGK|I Chain I, Structure Of Coi1-Ask1 In Complex With Coronatine And An Incomplete Jaz1 Degron gi|308388083|pdb|3OGK|K Chain K, Structure Of Coi1-Ask1 In Complex With Coronatine And An Incomplete Jaz1 Degron gi|308388086|pdb|3OGK|M Chain M, Structure Of Coi1-Ask1 In Complex With Coronatine And An Incomplete Jaz1 Degron gi|308388089|pdb|3OGK|O Chain O, Structure Of Coi1-Ask1 In Complex With Coronatine And An Incomplete Jaz1 Degron gi|308388092|pdb|3OGL|A Chain A, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And The Jaz1 Degron gi|308388095|pdb|3OGL|C Chain C, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And The Jaz1 Degron gi|308388098|pdb|3OGL|E Chain E, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And The Jaz1 Degron gi|308388101|pdb|3OGL|G Chain G, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And The Jaz1 Degron gi|308388103|pdb|3OGL|I Chain I, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And The Jaz1 Degron gi|308388106|pdb|3OGL|K Chain K, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And The Jaz1 Degron gi|308388109|pdb|3OGL|M Chain M, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And The Jaz1 Degron gi|308388112|pdb|3OGL|O Chain O, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And The Jaz1 Degron gi|308388115|pdb|3OGM|A Chain A, Structure Of Coi1-Ask1 In Complex With Coronatine And The Jaz1 Degron gi|308388118|pdb|3OGM|C Chain C, Structure Of Coi1-Ask1 In Complex With Coronatine And The Jaz1 Degron gi|308388121|pdb|3OGM|E Chain E, Structure Of Coi1-Ask1 In Complex With Coronatine And The Jaz1 Degron gi|308388124|pdb|3OGM|G Chain G, Structure Of Coi1-Ask1 In Complex With Coronatine And The Jaz1 Degron gi|308388126|pdb|3OGM|I Chain I, Structure Of Coi1-Ask1 In Complex With Coronatine And The Jaz1 Degron gi|308388129|pdb|3OGM|K Chain K, Structure Of Coi1-Ask1 In Complex With Coronatine And The Jaz1 Degron gi|308388132|pdb|3OGM|M Chain M, Structure Of Coi1-Ask1 In Complex With Coronatine And The Jaz1 Degron gi|308388135|pdb|3OGM|O Chain O, Structure Of Coi1-Ask1 In Complex With Coronatine And The Jaz1 Degron gi|6721107|gb|AAF26761.1|AC007396_10 T4O12.17 [Arabidopsis thaliana] gi|1432083|gb|AAB17535.1| homolog to Skp1p, an evolutionarily conserved kinetochore protein in budding yeast [Arabidopsis thaliana] gi|3068807|gb|AAC14444.1| Skp1 homolog [Arabidopsis thaliana] gi|3719209|gb|AAC63109.1| UIP1 [Arabidopsis thaliana] gi|19424110|gb|AAL87354.1| putative SKP1/ASK1 protein At1 [Arabidopsis thaliana] gi|21281127|gb|AAM45019.1| putative SKP1/ASK1 protein At1 [Arabidopsis thaliana] gi|332197659|gb|AEE35780.1| S-phase kinase-associated protein 1 [Arabidopsis thaliana] Length = 160 Score = 73.2 bits (178), Expect = 4e-11 Identities = 36/68 (52%), Positives = 44/68 (64%) Frame = -1 Query: 205 HMIEDDCVDNVIPIPNVTGKILSKVIEYCKRHXXXXXXXXXXXXXXXXXXXXXELKVFDA 26 HM+EDDCVDN +P+PNVT KIL+KVIEYCKRH +LK +DA Sbjct: 31 HMVEDDCVDNGVPLPNVTSKILAKVIEYCKRH--VEAAASKAEAVEGAATSDDDLKAWDA 88 Query: 25 DFVKVDQA 2 DF+K+DQA Sbjct: 89 DFMKIDQA 96 >emb|CAJ38399.1| fimbriata-associated protein [Plantago major] Length = 144 Score = 73.2 bits (178), Expect = 4e-11 Identities = 37/71 (52%), Positives = 44/71 (61%), Gaps = 3/71 (4%) Frame = -1 Query: 205 HMIEDDCVDNVIPIPNVTGKILSKVIEYCKRH---XXXXXXXXXXXXXXXXXXXXXELKV 35 HM+ED+C D++IP+PNVTGKILSKVIEYCKRH +LK Sbjct: 10 HMVEDECADSIIPLPNVTGKILSKVIEYCKRHVDAAAYSAAAKSDDKLASTATTDDDLKS 69 Query: 34 FDADFVKVDQA 2 FD DFVKVDQ+ Sbjct: 70 FDTDFVKVDQS 80 >ref|XP_007041813.1| S phase kinase-associated protein 1 [Theobroma cacao] gi|508705748|gb|EOX97644.1| S phase kinase-associated protein 1 [Theobroma cacao] Length = 156 Score = 72.8 bits (177), Expect = 5e-11 Identities = 37/67 (55%), Positives = 43/67 (64%) Frame = -1 Query: 205 HMIEDDCVDNVIPIPNVTGKILSKVIEYCKRHXXXXXXXXXXXXXXXXXXXXXELKVFDA 26 HMIEDDC DN IP+PNVT KIL+KV+EYCK+H +LKV+DA Sbjct: 33 HMIEDDCADNEIPVPNVTSKILAKVLEYCKKH--------VDAAADKEKIPEDDLKVWDA 84 Query: 25 DFVKVDQ 5 DFVKVDQ Sbjct: 85 DFVKVDQ 91 >gb|EMT03937.1| SKP1-like protein 1A [Aegilops tauschii] Length = 164 Score = 72.8 bits (177), Expect = 5e-11 Identities = 39/68 (57%), Positives = 42/68 (61%) Frame = -1 Query: 205 HMIEDDCVDNVIPIPNVTGKILSKVIEYCKRHXXXXXXXXXXXXXXXXXXXXXELKVFDA 26 HMIEDDC DN IP+PNV KILSKVIEYCK+H +LK FDA Sbjct: 36 HMIEDDCADNGIPLPNVDSKILSKVIEYCKKH---VQADASSSTSTAAPAPAEDLKSFDA 92 Query: 25 DFVKVDQA 2 DFVKVDQA Sbjct: 93 DFVKVDQA 100 >gb|AAC63273.1| SKP1-like protein [Nicotiana clevelandii] Length = 153 Score = 72.8 bits (177), Expect = 5e-11 Identities = 38/68 (55%), Positives = 42/68 (61%) Frame = -1 Query: 205 HMIEDDCVDNVIPIPNVTGKILSKVIEYCKRHXXXXXXXXXXXXXXXXXXXXXELKVFDA 26 HMIEDDC D IP+PNVT KIL+KVIEYCKRH +LK FDA Sbjct: 29 HMIEDDCADTSIPLPNVTSKILAKVIEYCKRH-------VDAASKTEDKAVEDDLKAFDA 81 Query: 25 DFVKVDQA 2 DFVKVDQ+ Sbjct: 82 DFVKVDQS 89 >gb|AAO85510.1| SKP1 [Nicotiana benthamiana] Length = 153 Score = 72.8 bits (177), Expect = 5e-11 Identities = 38/68 (55%), Positives = 42/68 (61%) Frame = -1 Query: 205 HMIEDDCVDNVIPIPNVTGKILSKVIEYCKRHXXXXXXXXXXXXXXXXXXXXXELKVFDA 26 HMIEDDC D IP+PNVT KIL+KVIEYCKRH +LK FDA Sbjct: 29 HMIEDDCADTSIPLPNVTSKILAKVIEYCKRH-------VDAASKTEDKAVEDDLKAFDA 81 Query: 25 DFVKVDQA 2 DFVKVDQ+ Sbjct: 82 DFVKVDQS 89 >ref|XP_006435227.1| hypothetical protein CICLE_v10002751mg [Citrus clementina] gi|568839457|ref|XP_006473700.1| PREDICTED: SKP1-like protein 1B-like [Citrus sinensis] gi|557537349|gb|ESR48467.1| hypothetical protein CICLE_v10002751mg [Citrus clementina] Length = 158 Score = 72.4 bits (176), Expect = 6e-11 Identities = 38/68 (55%), Positives = 42/68 (61%) Frame = -1 Query: 205 HMIEDDCVDNVIPIPNVTGKILSKVIEYCKRHXXXXXXXXXXXXXXXXXXXXXELKVFDA 26 HMIEDDC DN IP+PNVT KILSKVIEYCK+H +LK +D Sbjct: 32 HMIEDDCADNGIPLPNVTSKILSKVIEYCKKH-----VEASKSDDRATSGVDDDLKAWDT 86 Query: 25 DFVKVDQA 2 DFVKVDQA Sbjct: 87 DFVKVDQA 94 >ref|XP_004287783.1| PREDICTED: SKP1-like protein 1A-like [Fragaria vesca subsp. vesca] Length = 156 Score = 72.4 bits (176), Expect = 6e-11 Identities = 39/68 (57%), Positives = 43/68 (63%) Frame = -1 Query: 205 HMIEDDCVDNVIPIPNVTGKILSKVIEYCKRHXXXXXXXXXXXXXXXXXXXXXELKVFDA 26 HMIEDDC DN IP+PNVT KIL+KVIEYCK+H ELKV+D Sbjct: 33 HMIEDDCADNGIPLPNVTSKILAKVIEYCKKH--------VDAAKPDEKVTEEELKVWDQ 84 Query: 25 DFVKVDQA 2 DFVKVDQA Sbjct: 85 DFVKVDQA 92 >ref|XP_004250724.1| PREDICTED: SKP1-like protein 1A-like isoform 2 [Solanum lycopersicum] Length = 131 Score = 72.4 bits (176), Expect = 6e-11 Identities = 39/67 (58%), Positives = 41/67 (61%) Frame = -1 Query: 205 HMIEDDCVDNVIPIPNVTGKILSKVIEYCKRHXXXXXXXXXXXXXXXXXXXXXELKVFDA 26 HMIEDDC D IP+PNVT KIL+KVIEYCKRH ELK FDA Sbjct: 32 HMIEDDCADTSIPLPNVTSKILAKVIEYCKRH--------VDASKTEDKASEDELKTFDA 83 Query: 25 DFVKVDQ 5 DFVKVDQ Sbjct: 84 DFVKVDQ 90 >ref|XP_004250723.1| PREDICTED: SKP1-like protein 1A-like isoform 1 [Solanum lycopersicum] Length = 155 Score = 72.4 bits (176), Expect = 6e-11 Identities = 39/67 (58%), Positives = 41/67 (61%) Frame = -1 Query: 205 HMIEDDCVDNVIPIPNVTGKILSKVIEYCKRHXXXXXXXXXXXXXXXXXXXXXELKVFDA 26 HMIEDDC D IP+PNVT KIL+KVIEYCKRH ELK FDA Sbjct: 32 HMIEDDCADTSIPLPNVTSKILAKVIEYCKRH--------VDASKTEDKASEDELKTFDA 83 Query: 25 DFVKVDQ 5 DFVKVDQ Sbjct: 84 DFVKVDQ 90