BLASTX nr result
ID: Mentha27_contig00011598
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00011598 (253 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005554278.1| PREDICTED: uncharacterized protein LOC102118... 66 4e-09 ref|XP_002947412.1| histone H2B [Volvox carteri f. nagariensis] ... 64 3e-08 ref|XP_002956800.1| histone H2B [Volvox carteri f. nagariensis] ... 64 3e-08 gb|ADQ00181.1| histone H2B [Chlamydomonas sp. ICE-L] 64 3e-08 ref|XP_005851845.1| hypothetical protein CHLNCDRAFT_48411 [Chlor... 64 3e-08 ref|XP_005846939.1| hypothetical protein CHLNCDRAFT_23970 [Chlor... 64 3e-08 ref|XP_005843706.1| hypothetical protein CHLNCDRAFT_27882 [Chlor... 64 3e-08 ref|XP_005843694.1| hypothetical protein CHLNCDRAFT_27806 [Chlor... 64 3e-08 ref|XP_005843643.1| hypothetical protein CHLNCDRAFT_27834 [Chlor... 64 3e-08 ref|XP_005843124.1| hypothetical protein CHLNCDRAFT_55388 [Chlor... 64 3e-08 ref|XP_002947842.1| histone H2B [Volvox carteri f. nagariensis] ... 64 3e-08 ref|XP_002948276.1| histone H2B [Volvox carteri f. nagariensis] ... 64 3e-08 ref|XP_002948133.1| hypothetical protein VOLCADRAFT_116708 [Volv... 64 3e-08 ref|XP_002955481.1| histone H2B [Volvox carteri f. nagariensis] ... 64 3e-08 ref|XP_005643701.1| histone-fold-containing protein [Coccomyxa s... 63 4e-08 ref|XP_005643644.1| putative histone H2B, partial [Coccomyxa sub... 63 4e-08 ref|XP_002960295.1| hypothetical protein SELMODRAFT_73644 [Selag... 63 4e-08 ref|XP_002967418.1| hypothetical protein SELMODRAFT_87493 [Selag... 63 4e-08 ref|XP_002787385.1| histone H2B, putative [Perkinsus marinus ATC... 63 4e-08 ref|XP_002782087.1| histone 2B variant 2, putative [Perkinsus ma... 63 4e-08 >ref|XP_005554278.1| PREDICTED: uncharacterized protein LOC102118097 [Macaca fascicularis] Length = 556 Score = 66.2 bits (160), Expect = 4e-09 Identities = 36/56 (64%), Positives = 42/56 (75%) Frame = -1 Query: 253 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA*FLMIC*GFIFCVLGLDLDYGFLL 86 EIQTAVRL+LPGELAKHAVSEGTKAVTK+TS+ +L+ F F +L L D L Sbjct: 324 EIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSNYLLDFPMFFFHILNLIYDMNVCL 379 >ref|XP_002947412.1| histone H2B [Volvox carteri f. nagariensis] gi|122039|sp|P16867.3|H2B3_VOLCA RecName: Full=Histone H2B.3; AltName: Full=H2B-III gi|170656|gb|AAA34248.1| histone H2B-III [Volvox carteri] gi|300267276|gb|EFJ51460.1| histone H2B [Volvox carteri f. nagariensis] Length = 157 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 253 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 158 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA Sbjct: 126 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 157 >ref|XP_002956800.1| histone H2B [Volvox carteri f. nagariensis] gi|302850641|ref|XP_002956847.1| histone H2B [Volvox carteri f. nagariensis] gi|302850653|ref|XP_002956853.1| histone H2B [Volvox carteri f. nagariensis] gi|122041|sp|P16868.3|H2B4_VOLCA RecName: Full=Histone H2B.4; AltName: Full=H2B-IV gi|170659|gb|AAA34250.1| histone H2B-IV [Volvox carteri] gi|300257860|gb|EFJ42103.1| histone H2B [Volvox carteri f. nagariensis] gi|300257907|gb|EFJ42150.1| histone H2B [Volvox carteri f. nagariensis] gi|300257913|gb|EFJ42156.1| histone H2B [Volvox carteri f. nagariensis] Length = 155 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 253 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 158 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA Sbjct: 124 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 155 >gb|ADQ00181.1| histone H2B [Chlamydomonas sp. ICE-L] Length = 122 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 253 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 158 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA Sbjct: 91 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 122 >ref|XP_005851845.1| hypothetical protein CHLNCDRAFT_48411 [Chlorella variabilis] gi|307111509|gb|EFN59743.1| hypothetical protein CHLNCDRAFT_48411 [Chlorella variabilis] Length = 125 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 253 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 158 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA Sbjct: 94 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 125 >ref|XP_005846939.1| hypothetical protein CHLNCDRAFT_23970 [Chlorella variabilis] gi|307106592|gb|EFN54837.1| hypothetical protein CHLNCDRAFT_23970 [Chlorella variabilis] Length = 122 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 253 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 158 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA Sbjct: 91 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 122 >ref|XP_005843706.1| hypothetical protein CHLNCDRAFT_27882 [Chlorella variabilis] gi|307103343|gb|EFN51604.1| hypothetical protein CHLNCDRAFT_27882 [Chlorella variabilis] Length = 121 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 253 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 158 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA Sbjct: 90 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 121 >ref|XP_005843694.1| hypothetical protein CHLNCDRAFT_27806 [Chlorella variabilis] gi|307103331|gb|EFN51592.1| hypothetical protein CHLNCDRAFT_27806 [Chlorella variabilis] Length = 66 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 253 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 158 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA Sbjct: 35 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 66 >ref|XP_005843643.1| hypothetical protein CHLNCDRAFT_27834 [Chlorella variabilis] gi|307103280|gb|EFN51541.1| hypothetical protein CHLNCDRAFT_27834 [Chlorella variabilis] Length = 121 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 253 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 158 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA Sbjct: 90 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 121 >ref|XP_005843124.1| hypothetical protein CHLNCDRAFT_55388 [Chlorella variabilis] gi|552810176|ref|XP_005843134.1| hypothetical protein CHLNCDRAFT_28493 [Chlorella variabilis] gi|307102754|gb|EFN51022.1| hypothetical protein CHLNCDRAFT_55388 [Chlorella variabilis] gi|307102764|gb|EFN51032.1| hypothetical protein CHLNCDRAFT_28493 [Chlorella variabilis] Length = 122 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 253 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 158 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA Sbjct: 91 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 122 >ref|XP_002947842.1| histone H2B [Volvox carteri f. nagariensis] gi|300266644|gb|EFJ50830.1| histone H2B [Volvox carteri f. nagariensis] Length = 154 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 253 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 158 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA Sbjct: 123 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 154 >ref|XP_002948276.1| histone H2B [Volvox carteri f. nagariensis] gi|300266496|gb|EFJ50683.1| histone H2B [Volvox carteri f. nagariensis] Length = 155 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 253 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 158 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA Sbjct: 124 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 155 >ref|XP_002948133.1| hypothetical protein VOLCADRAFT_116708 [Volvox carteri f. nagariensis] gi|300266353|gb|EFJ50540.1| hypothetical protein VOLCADRAFT_116708 [Volvox carteri f. nagariensis] Length = 154 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 253 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 158 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA Sbjct: 123 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 154 >ref|XP_002955481.1| histone H2B [Volvox carteri f. nagariensis] gi|300259323|gb|EFJ43552.1| histone H2B [Volvox carteri f. nagariensis] Length = 156 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 253 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 158 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA Sbjct: 125 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 156 >ref|XP_005643701.1| histone-fold-containing protein [Coccomyxa subellipsoidea C-169] gi|384245664|gb|EIE19157.1| histone-fold-containing protein [Coccomyxa subellipsoidea C-169] Length = 119 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 253 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 158 EIQTAVRL+LPGELAKHAVSEGTKAVTKFTSA Sbjct: 88 EIQTAVRLILPGELAKHAVSEGTKAVTKFTSA 119 >ref|XP_005643644.1| putative histone H2B, partial [Coccomyxa subellipsoidea C-169] gi|545355764|ref|XP_005643657.1| putative histone H2B, partial [Coccomyxa subellipsoidea C-169] gi|545355800|ref|XP_005643675.1| putative histone H2B, partial [Coccomyxa subellipsoidea C-169] gi|545362333|ref|XP_005646407.1| putative histone H2B, partial [Coccomyxa subellipsoidea C-169] gi|545362345|ref|XP_005646412.1| putative histone H2B, partial [Coccomyxa subellipsoidea C-169] gi|545366577|ref|XP_005648176.1| putative histone H2B, partial [Coccomyxa subellipsoidea C-169] gi|384245607|gb|EIE19100.1| putative histone H2B, partial [Coccomyxa subellipsoidea C-169] gi|384245620|gb|EIE19113.1| putative histone H2B, partial [Coccomyxa subellipsoidea C-169] gi|384245638|gb|EIE19131.1| putative histone H2B, partial [Coccomyxa subellipsoidea C-169] gi|384248379|gb|EIE21863.1| putative histone H2B, partial [Coccomyxa subellipsoidea C-169] gi|384248384|gb|EIE21868.1| putative histone H2B, partial [Coccomyxa subellipsoidea C-169] gi|384250152|gb|EIE23632.1| putative histone H2B, partial [Coccomyxa subellipsoidea C-169] Length = 113 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 253 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 158 EIQTAVRL+LPGELAKHAVSEGTKAVTKFTSA Sbjct: 82 EIQTAVRLILPGELAKHAVSEGTKAVTKFTSA 113 >ref|XP_002960295.1| hypothetical protein SELMODRAFT_73644 [Selaginella moellendorffii] gi|300171234|gb|EFJ37834.1| hypothetical protein SELMODRAFT_73644 [Selaginella moellendorffii] Length = 146 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 253 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 158 EIQTAVRL+LPGELAKHAVSEGTKAVTKFTSA Sbjct: 115 EIQTAVRLILPGELAKHAVSEGTKAVTKFTSA 146 >ref|XP_002967418.1| hypothetical protein SELMODRAFT_87493 [Selaginella moellendorffii] gi|300165409|gb|EFJ32017.1| hypothetical protein SELMODRAFT_87493 [Selaginella moellendorffii] Length = 146 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 253 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 158 EIQTAVRL+LPGELAKHAVSEGTKAVTKFTSA Sbjct: 115 EIQTAVRLILPGELAKHAVSEGTKAVTKFTSA 146 >ref|XP_002787385.1| histone H2B, putative [Perkinsus marinus ATCC 50983] gi|239902357|gb|EER19181.1| histone H2B, putative [Perkinsus marinus ATCC 50983] Length = 113 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 253 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 158 EIQTA+RLVLPGELAKHAVSEGTKAVTKFTSA Sbjct: 82 EIQTAIRLVLPGELAKHAVSEGTKAVTKFTSA 113 >ref|XP_002782087.1| histone 2B variant 2, putative [Perkinsus marinus ATCC 50983] gi|239893464|gb|EER13882.1| histone 2B variant 2, putative [Perkinsus marinus ATCC 50983] Length = 112 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 253 EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 158 EIQTA+RLVLPGELAKHAVSEGTKAVTKFTSA Sbjct: 81 EIQTAIRLVLPGELAKHAVSEGTKAVTKFTSA 112