BLASTX nr result
ID: Mentha27_contig00011477
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00011477 (223 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21228.1| hypothetical protein MIMGU_mgv1a023092mg, partial... 66 6e-09 >gb|EYU21228.1| hypothetical protein MIMGU_mgv1a023092mg, partial [Mimulus guttatus] Length = 920 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/52 (59%), Positives = 38/52 (73%) Frame = +1 Query: 1 AFPKGSPLVFEVSREILKLKESQKMVSISKTWLEDGKSCPNGDGALSTSQSL 156 AFPKGSPLV +VSREIL LKE +KMV IS+ W + + CP GD + TS+ L Sbjct: 761 AFPKGSPLVPDVSREILNLKEDEKMVKISRKWFGEEEGCPGGDRTVITSERL 812